Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10270 86 / 1e-23 Wound-responsive family protein (.1) AT4G10265 80 / 2e-21 Wound-responsive family protein (.1) AT4G33560 54 / 7e-11 Wound-responsive family protein (.1) AT4G05070 36 / 0.0005 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039755 [exp] 92 / 6e-26 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10031616 [exp] 91 / 2e-25 AT4G10270 76 / 7e-20 Wound-responsive family protein (.1) Lus10018533 [exp] 90 / 5e-25 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039751 [exp] 89 / 2e-24 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10035008 [exp] 91 / 2e-23 AT1G18790 145 / 6e-42 RWP-RK domain containing 1, RWP-RK domain-containing protein (.1) Lus10039760 [exp] 85 / 3e-23 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039761 [exp] 84 / 1e-22 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 84 / 1e-22 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10018532 [exp] 83 / 2e-22 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116866 [exp] 95 / 5e-27 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117201 [exp] 94 / 6e-27 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117301 [exp] 94 / 9e-27 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G116500 [exp] 92 / 4e-26 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G117200 [exp] 91 / 1e-25 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G117632 [exp] 89 / 7e-25 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 89 / 9e-25 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 89 / 9e-25 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.013G148100 [exp] 89 / 1e-24 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.019G116932 [exp] 88 / 2e-24 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10033729 pacid=23143300 polypeptide=Lus10033729 locus=Lus10033729.g ID=Lus10033729.BGIv1.0 annot-version=v1.0 ATGAGCTCAACGAGCAGAGCTTGGACGGCGGCAGTTGCAGTGGGAGCAGTGGAGGCTCTGAAAGACCAAGGATTTTGTAGATGGAATCACGCCTTCCGAT CGATTCACCAACTCTCCAAGAACAAGATCAGGTCATCGTCATCGGCTTCAGTTTCCCGACAAGCTAAGGGAGCTAGGCAAGTCCGTAGGATTGTGGAAGA AGAACAGAGGGGAAACAGAGCAGAGGAGTCTCTCAGGACTGTTATGTACTTGAGTTGTTGGGGTCCTTACACTTAA
AA sequence Show only first row Show all	>Lus10033729 pacid=23143300 polypeptide=Lus10033729 locus=Lus10033729.g ID=Lus10033729.BGIv1.0 annot-version=v1.0 MSSTSRAWTAAVAVGAVEALKDQGFCRWNHAFRSIHQLSKNKIRSSSSASVSRQAKGARQVRRIVEEEQRGNRAEESLRTVMYLSCWGPYT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10270			Wound-responsive family protei...		Lus10033729 [exp]	0	1
AT4G09820	bHLH	BHLH42, TT8, bH...	TRANSPARENT TESTA 8, basic hel...		Lus10022032 [exp]	1.4	0.8333
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	1.4	0.8591
AT1G13340			Regulator of Vps4 activity in ...		Lus10041468 [exp]	3.0	0.7932
AT2G34690		ACD11	ACCELERATED CELL DEATH 11, Gly...		Lus10023267 [exp]	7.1	0.7698
AT5G62440			Protein of unknown function (D...		Lus10024968 [exp]	8.0	0.7903
AT1G21550			Calcium-binding EF-hand family...		Lus10042761 [exp]	8.7	0.7372
AT4G34970		ADF9	actin depolymerizing factor 9 ...		Lus10034494 [exp]	9.2	0.7410
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Lus10034397 [exp]	9.6	0.7205
AT1G20920			P-loop containing nucleoside t...		Lus10025525 [exp]	10.2	0.7561
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10013128 [exp]	11.7	0.7314

Compare expression of checked genes

Lus10033729 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.