Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 46 / 3e-08 Wound-responsive family protein (.1) AT4G10270 37 / 0.0001 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033729 [exp] 45 / 1e-07 AT4G10270 94 / 8e-27 Wound-responsive family protein (.1) Lus10039756 [exp] 44 / 2e-07 AT4G10265 95 / 3e-27 Wound-responsive family protein (.1) Lus10039755 [exp] 43 / 4e-07 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 40 / 6e-06 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10039749 [exp] 38 / 2e-05 AT4G10265 46 / 2e-08 Wound-responsive family protein (.1) Lus10018529 [exp] 38 / 3e-05 AT4G10265 46 / 2e-08 Wound-responsive family protein (.1) Lus10039760 [exp] 39 / 4e-05 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10039761 [exp] 37 / 0.0001 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 37 / 0.0001 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116500 [exp] 48 / 7e-09 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G117201 [exp] 46 / 2e-08 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G116866 [exp] 46 / 3e-08 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.013G148000 [exp] 45 / 6e-08 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1) Potri.019G116932 [exp] 45 / 9e-08 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 45 / 9e-08 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G116600 [exp] 45 / 1e-07 AT4G10270 82 / 4e-22 Wound-responsive family protein (.1) Potri.019G116700 [exp] 44 / 1e-07 AT4G10270 50 / 1e-09 Wound-responsive family protein (.1) Potri.013G148100 [exp] 44 / 2e-07 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.019G117700 [exp] 44 / 2e-07 AT4G10265 89 / 5e-25 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10033730 pacid=23143447 polypeptide=Lus10033730 locus=Lus10033730.g ID=Lus10033730.BGIv1.0 annot-version=v1.0 ATGAGTGCAAGTGCAACAACAAGCATCCGAGCACTTCACCAACGAGCCAAAAACTGGATGAGGGCTACCCCGGCGAAGCCATCCATCTCCCACCAGCCGG CCAAGCAGCACTCTTCTTCTTCTCCGGTGCCGGCCAACAATTTTCACGAGGCAGAGGATCCTCTTAGAACTGTCCTTTATTTGAGTTGTTGGGGTCCTTA CAACTGA
AA sequence Show only first row Show all	>Lus10033730 pacid=23143447 polypeptide=Lus10033730 locus=Lus10033730.g ID=Lus10033730.BGIv1.0 annot-version=v1.0 MSASATTSIRALHQRAKNWMRATPAKPSISHQPAKQHSSSSPVPANNFHEAEDPLRTVLYLSCWGPYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033730 [exp]	0	1
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10012691 [exp]	3.9	0.8574
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	4.0	0.9058
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002393 [exp]	5.7	0.8721
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10042946 [exp]	6.3	0.8889
AT4G04650			RNA-directed DNA polymerase (r...		Lus10008147 [exp]	6.4	0.7298
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	6.9	0.7882
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039502 [exp]	7.1	0.8862
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10024449 [exp]	7.7	0.8843
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	8.7	0.8837
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	9.5	0.8837

Compare expression of checked genes

Lus10033730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.