Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 85 / 3e-23 Wound-responsive family protein (.1) AT4G10270 76 / 2e-19 Wound-responsive family protein (.1) AT4G33560 37 / 0.0004 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031613 [exp] 133 / 4e-42 AT4G10265 104 / 7e-31 Wound-responsive family protein (.1) Lus10039760 [exp] 94 / 2e-26 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1) Lus10018530 [exp] 90 / 4e-25 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039752 [exp] 88 / 4e-24 AT4G10270 120 / 4e-37 Wound-responsive family protein (.1) Lus10039751 [exp] 87 / 6e-24 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039753 [exp] 85 / 8e-23 AT4G10265 120 / 4e-37 Wound-responsive family protein (.1) Lus10039755 [exp] 82 / 6e-22 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 82 / 7e-22 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10018532 [exp] 82 / 8e-22 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G148100 [exp] 77 / 8e-20 AT4G10270 103 / 1e-30 Wound-responsive family protein (.1) Potri.013G148000 [exp] 75 / 4e-19 AT4G10270 101 / 7e-30 Wound-responsive family protein (.1) Potri.019G116500 [exp] 71 / 1e-17 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G116932 [exp] 71 / 1e-17 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 71 / 1e-17 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G116866 [exp] 70 / 3e-17 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117700 [exp] 70 / 3e-17 AT4G10265 89 / 5e-25 Wound-responsive family protein (.1) Potri.019G117201 [exp] 70 / 4e-17 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117632 [exp] 69 / 9e-17 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117301 [exp] 69 / 1e-16 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10033731 pacid=23143237 polypeptide=Lus10033731 locus=Lus10033731.g ID=Lus10033731.BGIv1.0 annot-version=v1.0 ATGGCTACTAGTTCGACGGCGAGCAAGGCTTGGGGAGTGGCGGTCAGCATTGGAGCAGTGGAGGCACTGAAGGATCAGCTGGGTTTCTGCAGATGGAACC ACGTTATCAGATCGGCCCCGCAGTACGCTAGAAATTACAAAGCCAGAGCAATCTCTCAAGCCTCCAAGCTTTCTTCTCCTCCTCCTTCTGATGATGGAGG ATTGGTGAAGGAGGAATTAGCAGAGCGAAAGAGGAGGAGAAGAGAGGAGTCTTTGGAGAAAGTTATGTATTTGAACTCCTGGGGTCCGAAATGA
AA sequence Show only first row Show all	>Lus10033731 pacid=23143237 polypeptide=Lus10033731 locus=Lus10033731.g ID=Lus10033731.BGIv1.0 annot-version=v1.0 MATSSTASKAWGVAVSIGAVEALKDQLGFCRWNHVIRSAPQYARNYKARAISQASKLSSPPPSDDGGLVKEELAERKRRRREESLEKVMYLNSWGPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10033731 [exp]	0	1
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10035582 [exp]	1.0	0.9511
AT4G10265			Wound-responsive family protei...		Lus10039753 [exp]	2.8	0.9180
AT1G77120		ADH1, ATADH, AT...	ARABIDOPSIS THALIANA ALCOHOL D...		Lus10042787 [exp]	4.7	0.8994
AT4G10265			Wound-responsive family protei...		Lus10018532 [exp]	4.9	0.9323
AT1G20270			2-oxoglutarate (2OG) and Fe(II...		Lus10017249 [exp]	5.3	0.9116
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028469 [exp]	6.0	0.8985
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10000181 [exp]	6.5	0.8531
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10025252 [exp]	6.7	0.9061
AT1G67100	AS2	LBD40	LOB domain-containing protein ...		Lus10028470 [exp]	6.9	0.9089
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10008643 [exp]	7.3	0.9313

Compare expression of checked genes

Lus10033731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.