Lus10033751 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27310 105 / 4e-28 CO B-box type zinc finger family protein (.1)
AT5G54470 100 / 4e-26 CO B-box type zinc finger family protein (.1)
AT3G21890 58 / 4e-11 CO B-box type zinc finger family protein (.1)
AT3G21150 57 / 5e-10 CO EIP6, BBX32 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
AT4G15248 55 / 5e-10 CO B-box type zinc finger family protein (.1)
AT3G02380 54 / 8e-09 CO ATCOL2, COL2 CONSTANS-like 2 (.1)
AT1G68190 53 / 3e-08 CO B-box zinc finger family protein (.1)
AT4G15250 53 / 3e-08 CO COL11 B-box type zinc finger protein with CCT domain (.1)
AT5G15850 52 / 5e-08 CO COL1, ATCOL1 CONSTANS-like 1 (.1)
AT5G48250 52 / 5e-08 CO COL10 B-box type zinc finger protein with CCT domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031593 227 / 5e-76 AT4G27310 119 / 2e-33 B-box type zinc finger family protein (.1)
Lus10018513 138 / 2e-40 AT4G27310 117 / 3e-32 B-box type zinc finger family protein (.1)
Lus10039727 136 / 6e-40 AT5G54470 118 / 1e-32 B-box type zinc finger family protein (.1)
Lus10015097 73 / 8e-17 AT4G15248 94 / 5e-26 B-box type zinc finger family protein (.1)
Lus10031583 72 / 2e-16 AT3G21890 96 / 1e-26 B-box type zinc finger family protein (.1)
Lus10039694 66 / 5e-14 AT4G15248 108 / 1e-31 B-box type zinc finger family protein (.1)
Lus10027151 66 / 7e-14 AT4G15248 109 / 7e-32 B-box type zinc finger family protein (.1)
Lus10033380 64 / 2e-12 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
Lus10034830 62 / 8e-12 AT3G21150 112 / 3e-30 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G150500 122 / 1e-34 AT4G27310 114 / 1e-31 B-box type zinc finger family protein (.1)
Potri.004G026900 109 / 2e-30 AT4G27310 109 / 2e-30 B-box type zinc finger family protein (.1)
Potri.011G039700 108 / 1e-29 AT4G27310 105 / 3e-28 B-box type zinc finger family protein (.1)
Potri.001G414700 105 / 1e-27 AT5G54470 126 / 2e-35 B-box type zinc finger family protein (.1)
Potri.011G125400 105 / 3e-27 AT5G54470 120 / 1e-32 B-box type zinc finger family protein (.1)
Potri.004G027100 94 / 8e-25 AT5G54470 97 / 4e-26 B-box type zinc finger family protein (.1)
Potri.004G027000 83 / 5e-21 AT4G27310 91 / 5e-24 B-box type zinc finger family protein (.1)
Potri.010G251800 71 / 1e-14 AT3G21150 130 / 5e-37 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
Potri.007G121100 66 / 5e-14 AT4G15248 108 / 2e-31 B-box type zinc finger family protein (.1)
Potri.008G007000 67 / 1e-13 AT3G21150 128 / 3e-36 EMF1-Interacting Protein 1, B-box domain protein 32, B-box 32 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00643 zf-B_box B-box zinc finger
Representative CDS sequence
>Lus10033751 pacid=23143350 polypeptide=Lus10033751 locus=Lus10033751.g ID=Lus10033751.BGIv1.0 annot-version=v1.0
ATGAAGAATTGCGAGCTCTGCAAGTCCCCGGCGAGGACCTACTGCGAATCCGACGACGCTAGCCTCTGCTGGTCATGCGACGCCAATGTCCACGGAGCTA
ATTTCCTCGTCGCTCGTCACTCCCGCACTCTGCTCTGCCAATTGTGCCAGTCCGTAACTCCCTGGCAGGCCGCGGGTGCCAAGCTCGGAAACGCCTTCTC
GTTCTGTCTACGCTGCGCTAATGGAGACACTACTAATCGAGATGAAAGCGGAAGTGAGGAGGAAGAGGATGAAGATGATGAGATCGAGGAAGATCAGGAG
GAAGAGGAAGGAGATAATCAGGTTGTTCCATGGTCGTCATCCTCCGCCTCCACGCCGCCGCCTCCCCCTCCGGCTAGCGACAGCGAGGACTGTGAAGATT
TCGTCGAGTCTGATCAGAGGAGTCTAGATCTTAGATTCTTTCCTCAGGACGATATCAGCCGCCGATCTTCTCGTTCTAGACAGTCGGCGATCAGCTGTGA
CGATGATGATGATTCGTCGAGGCCGTTGAAAATCCGGAGGAGGGAAGGCGTCGATGAGCATGTTACGTCGAGGGAGAGTGGCCGTCCGATTTGA
AA sequence
>Lus10033751 pacid=23143350 polypeptide=Lus10033751 locus=Lus10033751.g ID=Lus10033751.BGIv1.0 annot-version=v1.0
MKNCELCKSPARTYCESDDASLCWSCDANVHGANFLVARHSRTLLCQLCQSVTPWQAAGAKLGNAFSFCLRCANGDTTNRDESGSEEEEDEDDEIEEDQE
EEEGDNQVVPWSSSSASTPPPPPPASDSEDCEDFVESDQRSLDLRFFPQDDISRRSSRSRQSAISCDDDDDSSRPLKIRRREGVDEHVTSRESGRPI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27310 CO B-box type zinc finger family ... Lus10033751 0 1
AT5G24930 CO COL4, ATCOL4 CONSTANS-like 4 (.1) Lus10026238 5.8 0.8893
AT1G06040 CO BBX24, STO SALT TOLERANCE, B-box domain p... Lus10027041 9.5 0.8551
AT4G02425 unknown protein Lus10030370 9.5 0.8232
AT4G32480 Protein of unknown function (D... Lus10006177 11.6 0.8488
AT4G15248 CO B-box type zinc finger family ... Lus10027151 19.6 0.8335
AT5G13770 Pentatricopeptide repeat (PPR-... Lus10035089 20.2 0.8393
AT1G06040 CO BBX24, STO SALT TOLERANCE, B-box domain p... Lus10025579 21.2 0.8461
AT3G18750 ZIK5, WNK6, ATW... ARABIDOPSIS THALIANA WITH NO K... Lus10030229 22.0 0.7956
AT4G27310 CO B-box type zinc finger family ... Lus10031593 24.0 0.8020
AT3G11670 DGD1 DIGALACTOSYL DIACYLGLYCEROL DE... Lus10021273 26.3 0.8038

Lus10033751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.