Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19660 82 / 1e-22 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012438 [exp] 115 / 6e-36 AT3G19660 84 / 1e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G290200 [exp] 94 / 3e-27 AT3G19660 71 / 2e-18 unknown protein Potri.009G085800 [exp] 89 / 2e-25 AT3G19660 64 / 2e-15 unknown protein Potri.017G109900 [exp] 60 / 4e-14 AT3G19660 49 / 1e-09 unknown protein Potri.017G109800 [exp] 55 / 4e-12 AT3G19660 50 / 6e-10 unknown protein Potri.004G105800 [exp] 52 / 2e-10 AT3G19660 41 / 3e-06 unknown protein Potri.004G105900 [exp] 50 / 4e-10 AT3G19660 46 / 2e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033765 pacid=23172842 polypeptide=Lus10033765 locus=Lus10033765.g ID=Lus10033765.BGIv1.0 annot-version=v1.0 ATGGCGATCCAGCTGGAGAGTCTTGTGGAGTCGATAAAGTCGAAGGTGAAAGGAGCGCTGAGGAGGAAGTCGAAGAAGAAGCCTTACGTGAAGATAGACA AGAGCGCTAGCGTCAGAGTCGAGATTCGCAGCCGCAAGGCCAAGCAGCTCATCGACAAGACGCTCAAGGTCGCCGATCGCCCTGGCAAGCGCAGCCTCTC TTAG
AA sequence Show only first row Show all	>Lus10033765 pacid=23172842 polypeptide=Lus10033765 locus=Lus10033765.g ID=Lus10033765.BGIv1.0 annot-version=v1.0 MAIQLESLVESIKSKVKGALRRKSKKKPYVKIDKSASVRVEIRSRKAKQLIDKTLKVADRPGKRSLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19660			unknown protein		Lus10033765 [exp]	0	1
AT5G54770		THI4, TZ, THI1	THIAZOLE REQUIRING, THIAMINE4,...		Lus10007646 [exp]	2.0	0.9116
AT3G43110			unknown protein		Lus10020796 [exp]	3.5	0.8990
AT5G20150		ATSPX1	ARABIDOPSIS THALIANA SPX DOMA...		Lus10019415 [exp]	5.5	0.8934
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10001479 [exp]	6.2	0.8496
AT5G20150		ATSPX1	ARABIDOPSIS THALIANA SPX DOMA...		Lus10030095 [exp]	6.3	0.8901
AT5G54770		THI4, TZ, THI1	THIAZOLE REQUIRING, THIAMINE4,...		Lus10018364 [exp]	8.1	0.8750
AT5G54740		SESA5	seed storage albumin 5 (.1)		Lus10023525 [exp]	8.7	0.8304
AT5G20150		ATSPX1	ARABIDOPSIS THALIANA SPX DOMA...		Lus10043272 [exp]	9.5	0.8620
AT1G05000		AtPFA-DSP1	plant and fungi atypical dual-...		Lus10031529 [exp]	11.5	0.8537
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Lus10002103 [exp]	11.8	0.8484

Compare expression of checked genes

Lus10033765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.