Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02410 50 / 5e-08 Concanavalin A-like lectin protein kinase family protein (.1) AT5G55830 47 / 8e-07 Concanavalin A-like lectin protein kinase family protein (.1) AT2G43690 46 / 1e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT2G43700 45 / 2e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT3G59730 45 / 3e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT4G28350 45 / 3e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT3G15356 44 / 6e-06 Legume lectin family protein (.1) AT5G10530 44 / 8e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT1G15530 43 / 1e-05 Concanavalin A-like lectin protein kinase family protein (.1) AT5G59270 43 / 1e-05 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014651 [exp] 202 / 2e-65 AT2G37710 96 / 3e-21 receptor lectin kinase (.1) Lus10033776 [exp] 181 / 2e-57 AT2G37710 91 / 8e-20 receptor lectin kinase (.1) Lus10014652 [exp] 170 / 9e-53 AT5G10530 92 / 4e-20 Concanavalin A-like lectin protein kinase family protein (.1) Lus10014649 [exp] 167 / 1e-51 AT5G10530 91 / 8e-20 Concanavalin A-like lectin protein kinase family protein (.1) Lus10033778 [exp] 158 / 2e-48 AT5G10530 92 / 4e-20 Concanavalin A-like lectin protein kinase family protein (.1) Lus10033779 [exp] 153 / 2e-46 AT5G10530 97 / 7e-22 Concanavalin A-like lectin protein kinase family protein (.1) Lus10033782 [exp] 151 / 2e-43 AT5G10530 351 / 2e-108 Concanavalin A-like lectin protein kinase family protein (.1) Lus10033781 [exp] 143 / 3e-43 AT5G10530 99 / 4e-23 Concanavalin A-like lectin protein kinase family protein (.1) Lus10033783 [exp] 74 / 2e-16 AT5G10530 468 / 2e-156 Concanavalin A-like lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G004200 [exp] 59 / 3e-11 AT5G10530 570 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283700 [exp] 56 / 5e-10 AT5G10530 497 / 7e-168 Concanavalin A-like lectin protein kinase family protein (.1) Potri.007G004500 [exp] 54 / 3e-09 AT5G10530 725 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.011G093700 [exp] 54 / 4e-09 AT5G55830 849 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283212 [exp] 53 / 4e-09 AT5G10530 385 / 3e-124 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G262866 [exp] 52 / 8e-09 AT5G10530 384 / 1e-124 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283200 [exp] 52 / 8e-09 AT5G10530 382 / 8e-125 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283866 [exp] 52 / 1e-08 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283208 [exp] 52 / 1e-08 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G368300 [exp] 52 / 1e-08 AT5G55830 853 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF00139 [flax] [poplar] Lectin_legB Legume lectin domain
Representative CDS sequence Show only first row Show all	>Lus10033777 pacid=23172841 polypeptide=Lus10033777 locus=Lus10033777.g ID=Lus10033777.BGIv1.0 annot-version=v1.0 ATGGACAACAACAACGGCAACTATACCTGCGACGGCCTAGCCTTCTTCATCGCCTCCTTCAATTACACCACTCCCGCCGTCAGTGCATCGGCCGATGGCC GTTTGGGTTTGGTAGACAGTAGCCACGAGTTCAATTCGACGGGGAATCCGTTCGTGGCGGTGGAGTTCGATACCAATTACAACTCCGAATGGAACACGTT GAGTGATATCCATGTTGGTATTAACATCAATTTAATAAAGTCCGTTGCGAGCAAGAGGTGGCGGAGTTATGCGAATGGGACGACTATGTCGGCCAGCGTG TCTTACAAAGCCAAAAACCTCTGCGTATGGTTCCGTGGTTCGCCTCCACTCTCTCGACGCCACCAATCTCACTGA
AA sequence Show only first row Show all	>Lus10033777 pacid=23172841 polypeptide=Lus10033777 locus=Lus10033777.g ID=Lus10033777.BGIv1.0 annot-version=v1.0 MDNNNGNYTCDGLAFFIASFNYTTPAVSASADGRLGLVDSSHEFNSTGNPFVAVEFDTNYNSEWNTLSDIHVGININLIKSVASKRWRSYANGTTMSASV SYKAKNLCVWFRGSPPLSRRHQSH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02410			Concanavalin A-like lectin pro...		Lus10033777 [exp]	0	1
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10010983 [exp]	3.0	0.8932
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Lus10000782 [exp]	3.3	0.8708
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10014163 [exp]	3.9	0.9002
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Lus10036136 [exp]	4.5	0.8852
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10000445 [exp]	4.9	0.8843
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10022005 [exp]	5.5	0.8967
AT4G26190			Haloacid dehalogenase-like hyd...		Lus10032890 [exp]	6.5	0.8658
AT4G28400			Protein phosphatase 2C family ...		Lus10028094 [exp]	8.2	0.8897
AT2G23140			RING/U-box superfamily protein...		Lus10011516 [exp]	8.5	0.8490
AT1G53400			Ubiquitin domain-containing pr...		Lus10007315 [exp]	11.8	0.8441

Compare expression of checked genes

Lus10033777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.