Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010268 [exp] 107 / 2e-28 AT5G67230 634 / 0.0 IRREGULAR XYLEM 14-LIKE, IRREGULAR XYLEM 14 Homolog, Nucleotide-diphospho-sugar transferases superfamily protein (.1) Lus10041601 [exp] 102 / 9e-27 AT5G67230 632 / 0.0 IRREGULAR XYLEM 14-LIKE, IRREGULAR XYLEM 14 Homolog, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033785 pacid=23172856 polypeptide=Lus10033785 locus=Lus10033785.g ID=Lus10033785.BGIv1.0 annot-version=v1.0 ATGTTCTGGCTCGTCCTCCTTGGGCTCTGCTGCCTCATCAGTCTCATCCTCGGATTCCGCTTTTCCCACCTGGTCTTCTTATTCCTTTTCTCCACTTCCG CCATCACTACCAACACCAATCACTTCATGGCGCCGTTTTGCCAGCTTACTACCACTGCTACCGTCGCTGACCTGCCAGTTAATGTTCCGTCCAACCCTGT CGCTGACGGCGGTGGCGTTCCCGTGGTCAACAGGACGGTGAGCTCTTCTAGAGTCGTGGTCGGGCGTCACGGGATTCGGATCCGGCCCGATCGAGGTAAT GAAGGCGCATCAGATAATTGA
AA sequence Show only first row Show all	>Lus10033785 pacid=23172856 polypeptide=Lus10033785 locus=Lus10033785.g ID=Lus10033785.BGIv1.0 annot-version=v1.0 MFWLVLLGLCCLISLILGFRFSHLVFLFLFSTSAITTNTNHFMAPFCQLTTTATVADLPVNVPSNPVADGGGVPVVNRTVSSSRVVVGRHGIRIRPDRGN EGASDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36890		IRX14	irregular xylem 14, Nucleotide...		Lus10033785 [exp]	0	1
AT4G20260		ATPCAP1	ARABIDOPSIS THALIANA PLASMA-ME...		Lus10038383 [exp]	2.0	0.9391
AT4G40010		SNRK2-7, SNRK2....	SUCROSE NONFERMENTING 1-RELATE...		Lus10037685 [exp]	2.2	0.9123
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10031676 [exp]	2.8	0.9300
AT4G00840			DHHC-type zinc finger family p...		Lus10002694 [exp]	3.5	0.8858
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10022883 [exp]	4.2	0.9215
AT2G42760			unknown protein		Lus10005429 [exp]	5.3	0.9172
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Lus10022915 [exp]	5.3	0.8971
AT1G78790			unknown protein		Lus10042782 [exp]	7.1	0.8688
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10038738 [exp]	8.8	0.9014
AT3G13235		DDI1	DNA-damage inducible 1, ubiqui...		Lus10020464 [exp]	9.5	0.8848

Compare expression of checked genes

Lus10033785 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.