Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53180 104 / 2e-27 NodGS nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023906 [exp] 113 / 3e-33 AT3G53180 199 / 2e-60 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10023900 [exp] 119 / 2e-32 AT3G53180 1148 / 0.0 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10024005 [exp] 106 / 2e-28 AT3G53180 247 / 3e-74 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10014407 [exp] 102 / 2e-26 AT3G53180 530 / 1e-175 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10023908 [exp] 73 / 1e-17 AT3G53180 115 / 5e-31 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G121000 [exp] 108 / 1e-28 AT3G53180 1176 / 0.0 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033799 pacid=23172820 polypeptide=Lus10033799 locus=Lus10033799.g ID=Lus10033799.BGIv1.0 annot-version=v1.0 ATGCTGGGGAAAGAGAACAGGGAAGCACCTCTGCGTACTGCTTGTCCTCCTGGCATCTCGGACGGCTTAGTCAGCAATTTCGAGATCAAGTCTTTCGATG GTTGCGGGAATCCACACCTCGGCTTGGCTGCTATAATAGCTGTTGGCATCGATGGACTCAGGAGGCATCTCGAACTGCCTGGAACCTATTGGTTACATCT ATGTTTGCAGGCTGAGATCGAGCACTACTCCAAGGACAAGGACGCTTACAAGCAAATGAGTTTAGCGTCTGGGTTGCTAGGCTCTGTTCAAGGTTTTCTA TTTGAGGTTGATTGGAAGTATGAATGCGATAGCTCTTAA
AA sequence Show only first row Show all	>Lus10033799 pacid=23172820 polypeptide=Lus10033799 locus=Lus10033799.g ID=Lus10033799.BGIv1.0 annot-version=v1.0 MLGKENREAPLRTACPPGISDGLVSNFEIKSFDGCGNPHLGLAAIIAVGIDGLRRHLELPGTYWLHLCLQAEIEHYSKDKDAYKQMSLASGLLGSVQGFL FEVDWKYECDSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10033799 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10027920 [exp]	1.4	0.8095
AT3G03530		NPC4	non-specific phospholipase C4 ...		Lus10028492 [exp]	1.7	0.8429
AT5G21280			hydroxyproline-rich glycoprote...		Lus10009801 [exp]	6.5	0.7888
AT5G01880			RING/U-box superfamily protein...		Lus10025144 [exp]	6.7	0.7407
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Lus10021664 [exp]	17.7	0.7614
AT5G39130			RmlC-like cupins superfamily p...		Lus10003267 [exp]	17.7	0.7802
AT5G16770	MYB	ATMYB9	myb domain protein 9 (.1.2)		Lus10001093 [exp]	31.7	0.7632
AT1G07180		NDA1, ATNDI1	ARABIDOPSIS THALIANA INTERNAL ...		Lus10020091 [exp]	33.1	0.7730
AT5G38200			Class I glutamine amidotransfe...		Lus10009152 [exp]	34.6	0.7268
AT3G26830		CYP71B15, PAD3	PHYTOALEXIN DEFICIENT 3, Cytoc...		Lus10011384 [exp]	38.4	0.7185

Compare expression of checked genes

Lus10033799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.