Lus10033806 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04520 209 / 8e-71 Nucleic acid-binding, OB-fold-like protein (.1)
AT5G35680 207 / 5e-70 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014627 219 / 2e-74 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10000920 216 / 3e-73 AT2G04520 252 / 1e-87 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10002264 211 / 2e-71 AT2G04520 248 / 6e-86 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10020713 140 / 1e-43 AT2G04520 169 / 4e-55 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10029827 139 / 6e-43 AT2G04520 168 / 9e-55 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10042438 94 / 2e-25 AT2G04520 100 / 5e-28 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10034249 42 / 5e-05 AT2G40780 197 / 4e-65 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10029014 40 / 0.0002 AT2G40780 199 / 4e-66 Nucleic acid-binding, OB-fold-like protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G219200 216 / 2e-73 AT2G04520 198 / 2e-66 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.014G160900 213 / 2e-72 AT2G04520 200 / 3e-67 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.002G031700 167 / 3e-54 AT2G04520 176 / 1e-57 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.014G093801 77 / 1e-19 AT2G04520 76 / 2e-19 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF01176 eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence
>Lus10033806 pacid=23172778 polypeptide=Lus10033806 locus=Lus10033806.g ID=Lus10033806.BGIv1.0 annot-version=v1.0
ATGCCGAAGAACAAGGGAAAGGGAGGAAAGAACAGGAAGAGAGGAAAGAATGAGGCAGATGACGAGAAGCGTGAGCTGATCTTTAAGGAAGATGGGCAGG
AGTATGCTCAGGTGATGCGCATGCTTGGTAATGGCCGCTGTGAAGCTACATGCATTGATGGCATCAAACGCCTATGCCATATTCGTGGCAAGATGCACAA
GAAGGTCTGGATCGCAGCTGGTGATATAATCCTTGTTGGGCTCAGGGACTATCAAGATGACAAGGCTGATGTTATCCTCAAGTACATGCCCGATGAAGCC
AGGCTTCTCAAGGCATACGGTGAACTTCCGGAGAATACTCGTCTCAATGAGGGTATTGCCGGAGGTATTGATGAGGAAGATGAGGGTGCCATTGACGACT
ATGTTGAGTTTGAAGATGAAGACATTGATAAAATCTAA
AA sequence
>Lus10033806 pacid=23172778 polypeptide=Lus10033806 locus=Lus10033806.g ID=Lus10033806.BGIv1.0 annot-version=v1.0
MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVMRMLGNGRCEATCIDGIKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEA
RLLKAYGELPENTRLNEGIAGGIDEEDEGAIDDYVEFEDEDIDKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10033806 0 1
AT5G04000 unknown protein Lus10042034 1.0 0.8942
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10023188 3.2 0.8626
AT1G65032 unknown protein Lus10007103 4.8 0.7629
AT4G08230 glycine-rich protein (.1.2) Lus10024100 4.9 0.8593
AT2G37975 Yos1-like protein (.1) Lus10000226 6.5 0.8172
AT1G27350 Ribosome associated membrane p... Lus10037031 6.9 0.7967
AT1G25275 unknown protein Lus10006792 7.5 0.8366
AT4G08460 Protein of unknown function (D... Lus10024758 7.9 0.8081
AT4G14880 OLD3, CYTACS1, ... ONSET OF LEAF DEATH 3, O-acety... Lus10019003 12.0 0.7850
AT1G27000 Protein of unknown function (D... Lus10037210 15.0 0.8118

Lus10033806 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.