Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033811 pacid=23172779 polypeptide=Lus10033811 locus=Lus10033811.g ID=Lus10033811.BGIv1.0 annot-version=v1.0 ATGAATGTCGATAATACAATATTGTCTAACTCAATTTCATTCGATGCCATATTAGCACTTATTTATGTACTCATTCATGTGTATAAAAAGGTGAGGACCG TGGGGAGTCTGGTAGTGCCTTTTGGCTTGTCTGAGGCATCAGAGGATGATAAAGTGTTAGAGGTCGGTGAAATTCCGGTGGTTGGGGCTGATGAGGTGAT GCCCGGAATCTCTCAGGTGGTGACGGCGGGGACTAGGGGAGCAAGGTAG
AA sequence Show only first row Show all	>Lus10033811 pacid=23172779 polypeptide=Lus10033811 locus=Lus10033811.g ID=Lus10033811.BGIv1.0 annot-version=v1.0 MNVDNTILSNSISFDAILALIYVLIHVYKKVRTVGSLVVPFGLSEASEDDKVLEVGEIPVVGADEVMPGISQVVTAGTRGAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033811 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10000843 [exp]	3.5	1.0000
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10002592 [exp]	3.9	1.0000
					Lus10002413 [exp]	4.2	1.0000
AT2G38500			2-oxoglutarate (2OG) and Fe(II...		Lus10006093 [exp]	5.3	1.0000
AT4G22756		ATSMO1-2, ATSMO...	sterol C4-methyl oxidase 1-2 (...		Lus10028908 [exp]	6.9	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10029383 [exp]	7.9	1.0000
AT1G75660		AtXRN3, XRN3	5'-3' exoribonuclease 3 (.1)		Lus10033153 [exp]	9.0	1.0000
AT1G07985			Expressed protein (.1)		Lus10029516 [exp]	10.2	1.0000
					Lus10014857 [exp]	10.2	1.0000
AT2G19110		ATHMA4, HMA4	ARABIDOPSIS HEAVY METAL ATPASE...		Lus10006956 [exp]	12.2	1.0000

Compare expression of checked genes

Lus10033811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.