Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19835 54 / 2e-10 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) AT1G47900 39 / 6e-05 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032386 [exp] 92 / 3e-26 AT1G19835 84 / 4e-20 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10012431 [exp] 95 / 1e-24 AT1G19835 901 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10024325 [exp] 93 / 4e-24 AT1G19835 787 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10024324 [exp] 93 / 4e-24 AT1G19835 919 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10033160 [exp] 70 / 4e-16 AT1G19835 949 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Lus10034510 [exp] 66 / 9e-15 AT1G19835 343 / 5e-108 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G024400 [exp] 66 / 1e-14 AT1G19835 941 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2) Potri.005G237100 [exp] 62 / 4e-13 AT1G19835 869 / 0.0 Plant protein of unknown function (DUF869) (.1), Plant protein of unknown function (DUF869) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033813 pacid=23172770 polypeptide=Lus10033813 locus=Lus10033813.g ID=Lus10033813.BGIv1.0 annot-version=v1.0 ATGGATAAAGCAAGTGAACTCCGGTTCAGTGTCCTTGGGTACAAACGTAATGAAGAGGAAATCAACAGCCCAGATTGTATAGATAAAGTTGCCTTACTAG AGAACAAGATTGTACAACAGGATGATGGTCCGTCATCATCGTCGTCATCTGGCGTGAGTTACGAAAATGGCTAG
AA sequence Show only first row Show all	>Lus10033813 pacid=23172770 polypeptide=Lus10033813 locus=Lus10033813.g ID=Lus10033813.BGIv1.0 annot-version=v1.0 MDKASELRFSVLGYKRNEEEINSPDCIDKVALLENKIVQQDDGPSSSSSSGVSYENG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19835			Plant protein of unknown funct...		Lus10033813 [exp]	0	1
AT1G07480			Transcription factor IIA, alph...		Lus10004981 [exp]	9.9	0.5954
					Lus10002077 [exp]	10.7	0.5216
					Lus10022112 [exp]	11.1	0.5881
					Lus10029758 [exp]	16.4	0.5916
AT5G04770		CAT6, ATCAT6	ARABIDOPSIS THALIANA CATIONIC ...		Lus10040142 [exp]	36.2	0.5669
AT4G36150			Disease resistance protein (TI...		Lus10026723 [exp]	38.5	0.5168
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10012552 [exp]	40.5	0.5718
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Lus10005050 [exp]	41.9	0.5173
AT3G62600		ATERDJ3B	DNAJ heat shock family protein...		Lus10022297 [exp]	46.0	0.5246
AT1G17930			Aminotransferase-like, plant m...		Lus10004818 [exp]	61.2	0.5200

Compare expression of checked genes

Lus10033813 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.