Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61230 224 / 1e-75 PIA2, ANK6 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) AT5G07840 223 / 3e-75 PIA1 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) AT2G03430 66 / 2e-13 Ankyrin repeat family protein (.1) AT5G53470 58 / 2e-10 ACBP1 acyl-CoA binding protein 1 (.1) AT2G31820 57 / 8e-10 Ankyrin repeat family protein (.1) AT5G02620 57 / 1e-09 ATANK1, ANK1 ankyrin-like1 (.1) AT2G28840 54 / 6e-09 XBAT31 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) AT2G43850 53 / 1e-08 Integrin-linked protein kinase family (.1.2) AT5G14230 53 / 2e-08 unknown protein AT4G19150 52 / 3e-08 Ankyrin repeat family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018958 [exp] 311 / 2e-110 AT5G07840 228 / 3e-77 phytochrome interacting ankyrin-repeat protein 1, Ankyrin repeat family protein (.1) Lus10007432 [exp] 64 / 2e-12 AT2G31800 69 / 3e-13 Integrin-linked protein kinase family (.1) Lus10040829 [exp] 61 / 3e-11 AT2G28840 546 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Lus10016561 [exp] 61 / 5e-11 AT2G28840 640 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Lus10020272 [exp] 58 / 4e-10 AT5G13530 97 / 9e-21 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10002621 [exp] 56 / 3e-09 AT5G13530 99 / 6e-22 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10036990 [exp] 54 / 2e-08 AT5G14230 510 / 5e-174 unknown protein Lus10023460 [exp] 53 / 2e-08 AT3G12360 929 / 0.0 INCREASED TOLERANCE TO NACL, Ankyrin repeat family protein (.1) Lus10036968 [exp] 51 / 3e-08 AT2G03430 216 / 7e-72 Ankyrin repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G104400 [exp] 248 / 3e-85 AT5G61230 217 / 4e-73 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) Potri.001G129800 [exp] 243 / 3e-83 AT5G61230 206 / 2e-68 phytochrome interacting ankyrin-repeat protein 2, ankyrin repeat protein 6, Ankyrin repeat family protein (.1) Potri.010G185200 [exp] 69 / 4e-14 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.013G062000 [exp] 65 / 1e-12 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.001G238800 [exp] 65 / 1e-12 AT2G28840 657 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2) Potri.007G145200 [exp] 62 / 2e-11 AT2G31820 751 / 0.0 Ankyrin repeat family protein (.1) Potri.003G103400 [exp] 58 / 2e-10 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2) Potri.001G130500 [exp] 58 / 2e-10 AT4G19150 222 / 1e-72 Ankyrin repeat family protein (.1.2) Potri.012G017700 [exp] 58 / 2e-10 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.009G030000 [exp] 57 / 5e-10 AT2G28840 619 / 0.0 XB3 ortholog 1 in Arabidopsis thaliana (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [flax] [poplar] Ank PF00023 [flax] [poplar] Ank Ankyrin repeat
Representative CDS sequence Show only first row Show all	>Lus10033816 pacid=23172775 polypeptide=Lus10033816 locus=Lus10033816.g ID=Lus10033816.BGIv1.0 annot-version=v1.0 ATGATCCAGGAAAGGCTGTTAAGGCGTACTTTCTCAAAGAAACGGTCTTTTAAGGTTGGGAGCGATAGGGATGATAGGGGCTGGACTACGCTCCATGTTG GCGCCAGAAAGGGCGATGTGAAGGAAGTAAAGCGGCTGCTAGACGATGGAATGGACGTCAACGTTCCAGCTTGGGGTCCGAAAGCGAAAGGGGTGACTCC TCTCCACCTGGCTGCTGAGGGTGGGCATCTCGATGTCATGGATGAACTGTTGGAACGCGGAGCTAACATCGATGCCAGGACTAAGGGTGCTTGTGGCTGG ACGCCTCTGCACATTGCTGCTAAGGAGAGGAATAGGGTAGCTGTCAAGTTTCTGATAGAGAACGGAGCATTCTTGCCTGATGACATCAACGACTGTAGGT TCAATCCGCCGCTCCATTACTGCCCCGGTCTGGAATGGGCGTATGAGGAGATGAAGAAGTATCAGAGTGAGAGTTTTTCGTCATCTGGGGAAGCGTCTGA CAGCTCTGAGAGTTTATGCATTTAG
AA sequence Show only first row Show all	>Lus10033816 pacid=23172775 polypeptide=Lus10033816 locus=Lus10033816.g ID=Lus10033816.BGIv1.0 annot-version=v1.0 MIQERLLRRTFSKKRSFKVGSDRDDRGWTTLHVGARKGDVKEVKRLLDDGMDVNVPAWGPKAKGVTPLHLAAEGGHLDVMDELLERGANIDARTKGACGW TPLHIAAKERNRVAVKFLIENGAFLPDDINDCRFNPPLHYCPGLEWAYEEMKKYQSESFSSSGEASDSSESLCI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07840		PIA1	phytochrome interacting ankyri...		Lus10033816 [exp]	0	1
AT5G07840		PIA1	phytochrome interacting ankyri...		Lus10018958 [exp]	1.0	0.9302
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	2.0	0.9122
AT4G25670			unknown protein		Lus10027511 [exp]	3.0	0.9025
AT5G50380		ATEXO70F1	exocyst subunit exo70 family p...		Lus10022459 [exp]	4.2	0.8985
AT3G11280	MYB		Duplicated homeodomain-like su...		Lus10040225 [exp]	4.4	0.8626
AT3G11280	MYB		Duplicated homeodomain-like su...		Lus10028264 [exp]	4.5	0.8626
AT3G57340			Heat shock protein DnaJ, N-ter...		Lus10043277 [exp]	4.5	0.9018
AT2G18050		HIS1-3	histone H1-3 (.1.2)		Lus10025968 [exp]	4.7	0.8620
AT3G57340			Heat shock protein DnaJ, N-ter...		Lus10019421 [exp]	6.7	0.9008
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Lus10038893 [exp]	7.5	0.8720

Compare expression of checked genes

Lus10033816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.