Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06240 44 / 7e-06 F-box family protein (.1) AT4G12560 44 / 9e-06 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018968 [exp] 180 / 3e-58 ND 38 / 0.004 Lus10018972 [exp] 133 / 3e-37 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10033825 [exp] 74 / 2e-16 AT5G36930 400 / 3e-123 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10001105 [exp] 62 / 4e-12 AT3G06240 109 / 3e-26 F-box family protein (.1) Lus10013988 [exp] 62 / 4e-12 AT3G49180 471 / 4e-160 ROOT INITIATION DEFECTIVE 3, Transducin/WD40 repeat-like superfamily protein (.1) Lus10009424 [exp] 56 / 4e-10 AT3G06240 73 / 9e-14 F-box family protein (.1) Lus10028961 [exp] 55 / 1e-09 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10015408 [exp] 54 / 2e-09 AT3G16210 64 / 6e-11 F-box family protein (.1) Lus10027824 [exp] 53 / 5e-09 AT3G06240 78 / 2e-15 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G035500 [exp] 54 / 1e-09 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G012900 [exp] 50 / 6e-08 AT4G12560 144 / 2e-39 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.003G145950 [exp] 47 / 4e-07 AT4G12560 113 / 7e-28 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G013000 [exp] 46 / 1e-06 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.012G099733 [exp] 43 / 1e-05 AT3G16210 92 / 2e-20 F-box family protein (.1) Potri.008G006900 [exp] 43 / 2e-05 AT4G12560 95 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G011400 [exp] 41 / 5e-05 AT4G12560 142 / 2e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G262900 [exp] 40 / 9e-05 AT4G12560 107 / 5e-26 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.010G207500 [exp] 39 / 0.0003 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.010G154500 [exp] 38 / 0.0006 AT4G12560 139 / 7e-37 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033824 pacid=23172878 polypeptide=Lus10033824 locus=Lus10033824.g ID=Lus10033824.BGIv1.0 annot-version=v1.0 ATGGATGCATGGGCCTCTGACATCATCCTCTGGAATCCGTCAACTTCCGAAACCATGATCCTGCCGCGTTCTCCCTTAATGGACGCAAAAATGGATGCAA CAGTGAAGGACAGAGACCGTTTCTTTACAGAACCGATTGGGTTCGGGTTCGACCCACTTACGGATGACTACAAAGTGCTAAGGTGGATTAACTACATTGG AGATCCTTATTACACAGAAGATGGACATTCTTTTTCCAAAGGATGGGATGCTGCTGAGGTTTACAGCTTGAAGGATCAATCATGGACACCACTTGCGACT TGTAAGTCCTCCGTGGGTGCTAACCCATTCCGTCAGCACCATACATCTTGGTACGAGATGCTTTACTGA
AA sequence Show only first row Show all	>Lus10033824 pacid=23172878 polypeptide=Lus10033824 locus=Lus10033824.g ID=Lus10033824.BGIv1.0 annot-version=v1.0 MDAWASDIILWNPSTSETMILPRSPLMDAKMDATVKDRDRFFTEPIGFGFDPLTDDYKVLRWINYIGDPYYTEDGHSFSKGWDAAEVYSLKDQSWTPLAT CKSSVGANPFRQHHTSWYEMLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033824 [exp]	0	1
AT1G31650		ATROPGEF14, ROP...	RHO guanyl-nucleotide exchange...		Lus10037260 [exp]	4.6	0.8378
AT4G02820			Pentatricopeptide repeat (PPR)...		Lus10042574 [exp]	7.9	0.7985
AT2G40720			Tetratricopeptide repeat (TPR)...		Lus10027366 [exp]	20.1	0.7918
AT1G61010		CPSF73-I	cleavage and polyadenylation s...		Lus10015460 [exp]	26.8	0.7664
AT1G62390		CLMP1, Phox2	Phox2, CLUMPED CHLOROPLASTS 1,...		Lus10039592 [exp]	28.8	0.7671
AT5G18950			Tetratricopeptide repeat (TPR)...		Lus10024666 [exp]	31.1	0.7503
AT1G29880			glycyl-tRNA synthetase / glyci...		Lus10008792 [exp]	37.4	0.7789
AT5G20300		Toc90	translocon at the outer envelo...		Lus10006471 [exp]	40.0	0.7817
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031837 [exp]	40.1	0.7840
AT4G03220			Protein with RNI-like/FBD-like...		Lus10006970 [exp]	47.2	0.7665

Compare expression of checked genes

Lus10033824 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.