Lus10033833 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05780 146 / 5e-47 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
AT2G31710 132 / 1e-41 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018982 184 / 2e-61 AT1G05780 129 / 2e-39 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G160500 163 / 7e-54 AT1G05780 138 / 6e-44 Vacuolar ATPase assembly integral membrane protein VMA21-like domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09446 VMA21 VMA21-like domain
Representative CDS sequence
>Lus10033833 pacid=23172801 polypeptide=Lus10033833 locus=Lus10033833.g ID=Lus10033833.BGIv1.0 annot-version=v1.0
ATGTCAGGAGTGGTGCAGAAGTTCTTCATCACTTCAATGCTCATGTGGATGGCTCCAATTGCGATCCTGTATGCATTCAACCACAACTTGCTTCCCGGTA
TAACTAAAATGTCCCCGCATTCTCTGACGTTGGTGAGTGGATTTGTTGCTGTTATATCGGTGAACATCATGATTGCGTTCTACATATGTATGGCAATGAA
GGAACCCGTGGATAAACATGAGCCAGATCCTACATTTGTTGCTCTAGCTCAAGATAGCGTGACCAAACTCACCGGCGGCAAAGCCGTTGATTCTCCTGAA
TCGTCAAAGAAAGAAGAATAG
AA sequence
>Lus10033833 pacid=23172801 polypeptide=Lus10033833 locus=Lus10033833.g ID=Lus10033833.BGIv1.0 annot-version=v1.0
MSGVVQKFFITSMLMWMAPIAILYAFNHNLLPGITKMSPHSLTLVSGFVAVISVNIMIAFYICMAMKEPVDKHEPDPTFVALAQDSVTKLTGGKAVDSPE
SSKKEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05780 Vacuolar ATPase assembly integ... Lus10033833 0 1
AT1G60490 PI3K, ATVPS34 PHOSPATIDYLINOSITOL 3-KINASE, ... Lus10030605 1.4 0.9100
AT3G62720 ATXT1, XXT1 XYG XYLOSYLTRANSFERASE 1, xylo... Lus10037514 4.9 0.8875
AT5G45420 MYB maMYB membrane anchored MYB, Duplica... Lus10039841 6.2 0.9053
AT2G45260 Plant protein of unknown funct... Lus10030291 6.6 0.8837
AT4G09670 Oxidoreductase family protein ... Lus10013633 7.0 0.8888
AT3G55830 EPC1 ECTOPICALLY PARTING CELLS, Nuc... Lus10027392 8.5 0.8817
AT2G18840 Integral membrane Yip1 family ... Lus10025478 8.7 0.9010
AT1G03350 BSD domain-containing protein ... Lus10029636 9.2 0.8891
AT1G79870 D-isomer specific 2-hydroxyaci... Lus10025796 9.5 0.8839
AT5G42090 Lung seven transmembrane recep... Lus10033235 9.6 0.8981

Lus10033833 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.