Lus10033856 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09510 266 / 7e-93 Ribosomal protein S19 family protein (.1.2)
AT5G09500 266 / 7e-93 Ribosomal protein S19 family protein (.1)
AT1G04270 264 / 4e-92 RPS15 cytosolic ribosomal protein S15 (.1.2)
AT5G09490 260 / 1e-90 Ribosomal protein S19 family protein (.1)
AT5G43640 241 / 3e-83 Ribosomal protein S19 family protein (.1)
AT5G63070 192 / 1e-63 Ribosomal protein S19 family protein (.1)
AT1G33850 77 / 3e-19 Ribosomal protein S19 family protein (.1)
ATCG00820 45 / 1e-06 ATCG00820.1, RPS19 ribosomal protein S19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018777 307 / 4e-109 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2)
Lus10041168 301 / 2e-105 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2)
Lus10021886 283 / 3e-97 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1)
Lus10007469 265 / 1e-92 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1)
Lus10026127 246 / 5e-85 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1)
Lus10024865 241 / 1e-83 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1)
Lus10008692 166 / 6e-54 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1)
Lus10027711 43 / 1e-05 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1)
Lus10003009 42 / 8e-05 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G076900 290 / 2e-102 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2)
Potri.002G043200 289 / 3e-102 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1)
Potri.005G219700 276 / 7e-97 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1)
Potri.008G161901 131 / 6e-41 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2)
Potri.005G055401 95 / 3e-26 AT1G04270 97 / 3e-27 cytosolic ribosomal protein S15 (.1.2)
Potri.005G055534 76 / 4e-18 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2)
Potri.003G123750 67 / 2e-15 AT1G04270 67 / 4e-16 cytosolic ribosomal protein S15 (.1.2)
Potri.004G074201 55 / 1e-10 AT5G09500 52 / 1e-09 Ribosomal protein S19 family protein (.1)
Potri.013G137688 44 / 2e-06 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1)
Potri.011G074301 44 / 2e-06 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00203 Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence
>Lus10033856 pacid=23172734 polypeptide=Lus10033856 locus=Lus10033856.g ID=Lus10033856.BGIv1.0 annot-version=v1.0
ATGGCGGAAATTGAAGCCGATGTTGCCGTTCCCGGACAGCCGAAGAAGAGGACGTTCAAGAAGTTCAGTTTCAGGGGAGTTGATCTGGATGCACTCTTGG
ACATGTCTACTGATGACCTTGTCAAGCTCTTCACTGCTCGCGCTCGCAGAAGGTTCCAGCGTGGTTTGACTAGGAAGCCAATGGCTCTCGTTAAGAAGCT
CCGCAAGGCGAAAAGGGAGGCTCCAGCTGGTGAGAAGCCAGAGCCAGTGAGGACTCACCTCCGAAACATGATCATAGTCCCGGAGATGATCGGCAGCGTC
ATTGGTGTCTACAATGGCAAGACATTCAACCAGGTTGAAATCAAGCCTGAGATGATTGGTCACTATCTGGCCGAGTTCTCGATCAGTTACAAGCCGGTGA
AGCATGGAAGACCTGGTATTGGTGCCACCCACTCCTCCAGGTTCATCCCTCTCAAGTGA
AA sequence
>Lus10033856 pacid=23172734 polypeptide=Lus10033856 locus=Lus10033856.g ID=Lus10033856.BGIv1.0 annot-version=v1.0
MAEIEADVAVPGQPKKRTFKKFSFRGVDLDALLDMSTDDLVKLFTARARRRFQRGLTRKPMALVKKLRKAKREAPAGEKPEPVRTHLRNMIIVPEMIGSV
IGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09510 Ribosomal protein S19 family p... Lus10033856 0 1
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 1.7 0.9809
AT4G16720 Ribosomal protein L23/L15e fam... Lus10028965 2.0 0.9752
AT5G15200 Ribosomal protein S4 (.1.2) Lus10008624 3.2 0.9764
AT2G42740 RPL16A ribosomal protein large subuni... Lus10017648 3.5 0.9764
AT4G15000 Ribosomal L27e protein family ... Lus10003814 3.7 0.9488
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10005883 4.7 0.9514
AT4G18100 Ribosomal protein L32e (.1) Lus10011970 5.3 0.9636
AT2G09990 Ribosomal protein S5 domain 2-... Lus10035133 5.5 0.9526
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 6.3 0.9723
AT3G16080 Zinc-binding ribosomal protein... Lus10037549 6.5 0.9644

Lus10033856 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.