Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33100 106 / 1e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014752 [exp] 179 / 1e-60 AT4G33100 105 / 2e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G224400 [exp] 119 / 1e-36 AT4G33100 108 / 1e-32 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05254 [flax] [poplar] UPF0203 Uncharacterised protein family (UPF0203)
Representative CDS sequence Show only first row Show all	>Lus10033863 pacid=23172888 polypeptide=Lus10033863 locus=Lus10033863.g ID=Lus10033863.BGIv1.0 annot-version=v1.0 ATGGGGATTATGAGAAAAGAGAAGCAACTTCCAACTCCCTCTTCAACTTCGCCTTGTGCTTCTCTCAGATCAGCTTATCACATTTGCTTCAACAGGTGGT ACTCGGAGAAGTTTGCTAAGGGTCAGTGGGACAGAATGGAATGCGTTTCTGAGTGGGATAACTACATGGATTGCCTCTCTAAGCACTTGGATGATAAGCA GCTGCGTCGTTTCTTGGAGGCTGAACTTGTTCCCTCCGACTTGGTGGGTTCCGCCGCATCTGCAACAAATTGA
AA sequence Show only first row Show all	>Lus10033863 pacid=23172888 polypeptide=Lus10033863 locus=Lus10033863.g ID=Lus10033863.BGIv1.0 annot-version=v1.0 MGIMRKEKQLPTPSSTSPCASLRSAYHICFNRWYSEKFAKGQWDRMECVSEWDNYMDCLSKHLDDKQLRRFLEAELVPSDLVGSAASATN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33100			unknown protein		Lus10033863 [exp]	0	1
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031006 [exp]	6.2	0.8949
AT5G57230			Thioredoxin superfamily protei...		Lus10003582 [exp]	10.8	0.8742
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10036870 [exp]	22.5	0.8602
AT5G52545			unknown protein		Lus10014958 [exp]	26.7	0.8414
AT2G26990		COP12, ATCSN2, ...	FUSCA 12, CONSTITUTIVE PHOTOMO...		Lus10041295 [exp]	35.7	0.8658
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Lus10028400 [exp]	39.6	0.8147
AT1G55340			Protein of unknown function (D...		Lus10013412 [exp]	41.8	0.8685
AT1G04590		EMB2748	unknown protein		Lus10019008 [exp]	44.9	0.8602
AT1G28560		SRD2	SHOOT REDIFFERENTIATION DEFECT...		Lus10017968 [exp]	50.8	0.8618
AT3G16230			Predicted eukaryotic LigT (.1....		Lus10006828 [exp]	50.9	0.8613

Compare expression of checked genes

Lus10033863 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.