Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59530 102 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59540 101 / 3e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06650 98 / 4e-24 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06620 97 / 1e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43450 96 / 2e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 96 / 3e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G04380 95 / 7e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 94 / 2e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06645 94 / 2e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04350 92 / 6e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000612 [exp] 157 / 1e-46 AT5G59540 337 / 2e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10000611 [exp] 154 / 2e-44 AT1G06620 250 / 7e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10033877 [exp] 144 / 2e-42 AT1G06620 223 / 2e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000610 [exp] 120 / 2e-34 AT5G59530 170 / 1e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10033879 [exp] 110 / 9e-29 AT5G59540 312 / 8e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10002888 [exp] 100 / 1e-24 AT1G06620 384 / 7e-133 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10033878 [exp] 101 / 2e-24 AT5G59540 308 / 4e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041230 [exp] 95 / 5e-24 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017080 [exp] 97 / 8e-24 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G136000 [exp] 120 / 3e-32 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 117 / 3e-31 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G222300 [exp] 116 / 9e-31 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 108 / 8e-28 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 107 / 1e-27 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 102 / 2e-25 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G073166 [exp] 99 / 1e-24 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 94 / 2e-22 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G165400 [exp] 89 / 1e-20 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073232 [exp] 87 / 5e-20 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10033875 pacid=23172750 polypeptide=Lus10033875 locus=Lus10033875.g ID=Lus10033875.BGIv1.0 annot-version=v1.0 ATGCAACTGATTACAAATGACAAATTCAAGAGCGTAGAGCATAAAGTTGTGGTTGGAGATGAGCAAGGCGGAAATGAAGTATCCGTGGCAAGCCTTTTCT ATCCAAACTCTTCCAATAATCTCAAATCATGTGGGCCTCCTAATGAGCTTCTTTCGTATGGAAGCCCACCAATCTACAGGGATTCTCATTTCACTGAATT TATGGAACATTATAGGTCCAAAGGATTGGATGGCAAACCTGCACTCTCTCATTTCAGACGTCCGAGCCTGCAAGCATACGGACCCATACTTTCTCACCAT AATCCTCCAAGACAGCACAGGTGGGCTCAGGTCCTGCACCGGGGTCCATGGGTCGATGTGCCGGCACGACGTGGAGCCTTGGTGGTGAACATTGGAGACT TTTTGCAGCTGATCACCAACGACATGTTCAAGAGCGTGGAGCACCGGGTCAAAGTATGGAGCTCCACGGCCAGTTGTTCAGTTGTTAGCTTCTTCTTACC CGGTTCGGAGAACATGATGAAACCGTATGGTCCGGCGAAGGAGCTTCTGTGTGAGGAGAATCCGGCGGTGTATAGAGACACGCATATCTCTGAGTTTCTT GATTGCTTCATGTCTGGTGGCTCCCCACTTTCTCATTTTAGATTGTGGTCGTGA
AA sequence Show only first row Show all	>Lus10033875 pacid=23172750 polypeptide=Lus10033875 locus=Lus10033875.g ID=Lus10033875.BGIv1.0 annot-version=v1.0 MQLITNDKFKSVEHKVVVGDEQGGNEVSVASLFYPNSSNNLKSCGPPNELLSYGSPPIYRDSHFTEFMEHYRSKGLDGKPALSHFRRPSLQAYGPILSHH NPPRQHRWAQVLHRGPWVDVPARRGALVVNIGDFLQLITNDMFKSVEHRVKVWSSTASCSVVSFFLPGSENMMKPYGPAKELLCEENPAVYRDTHISEFL DCFMSGGSPLSHFRLWS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59530			2-oxoglutarate (2OG) and Fe(II...		Lus10033875 [exp]	0	1
AT2G38300	GARP		myb-like HTH transcriptional r...		Lus10017442 [exp]	2.2	0.9479
AT3G02645			Plant protein of unknown funct...		Lus10019721 [exp]	5.7	0.9274
AT1G29280	WRKY	ATWRKY65, WRKY6...	WRKY DNA-binding protein 65 (....		Lus10007305 [exp]	5.7	0.9418
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10028897 [exp]	7.7	0.9373
AT2G35270	AT-hook	GIK, 2-ATH, AHL...	GIANT KILLER, Predicted AT-hoo...		Lus10030966 [exp]	8.1	0.9381
AT5G47650		ATNUDX2, ATNUDT...	ARABIDOPSIS THALIANA NUDIX HYD...		Lus10012320 [exp]	9.2	0.9054
AT1G65610		ATGH9A2 ,KOR2	KORRIGAN 2, ARABIDOPSIS THALIA...		Lus10026863 [exp]	9.8	0.9235
AT1G24130			Transducin/WD40 repeat-like su...		Lus10029206 [exp]	11.2	0.9068
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10016388 [exp]	13.1	0.9272
AT4G27870			Vacuolar iron transporter (VIT...		Lus10022771 [exp]	13.7	0.9245

Compare expression of checked genes

Lus10033875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.