Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06650 55 / 2e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06645 54 / 3e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 54 / 5e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT2G30840 53 / 1e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 52 / 2e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G25450 52 / 3e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06620 49 / 4e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03400 48 / 7e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59540 47 / 1e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G59530 47 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033879 [exp] 66 / 4e-14 AT5G59540 312 / 8e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10000612 [exp] 66 / 4e-14 AT5G59540 337 / 2e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10033878 [exp] 62 / 8e-13 AT5G59540 308 / 4e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10001108 [exp] 59 / 1e-11 AT1G06620 362 / 2e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022195 [exp] 58 / 2e-11 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022415 [exp] 57 / 5e-11 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 56 / 9e-11 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004888 [exp] 56 / 2e-10 AT1G06620 392 / 1e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10001109 [exp] 55 / 3e-10 AT1G06620 379 / 4e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G222300 [exp] 62 / 9e-13 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G107500 [exp] 60 / 5e-12 AT1G03400 302 / 3e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G165400 [exp] 59 / 8e-12 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 59 / 1e-11 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073166 [exp] 58 / 2e-11 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 56 / 9e-11 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G136000 [exp] 56 / 1e-10 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 56 / 1e-10 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.004G083100 [exp] 56 / 1e-10 AT1G04350 287 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 56 / 2e-10 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033876 pacid=23172828 polypeptide=Lus10033876 locus=Lus10033876.g ID=Lus10033876.BGIv1.0 annot-version=v1.0 ATGGATAAGTTAGACGGCGGCGTAACATCATCAACCCCCATGAAAATCTCCGATCATCTTCTTCTTCCTCCGATCTCATCATCTAAACCAAACTACAACA ACAGCCCCTACGACAGAAACGCCGACATAAAGGCATTTGACGACACCAAAGCCGGCGTTAAAGGACTGGTGGACTCCGGAGTCACCACCATCCCTCGCTT ATTCATCCACCACCGTACTCCTCCGACTGATCAGTATTGGAAATGA
AA sequence Show only first row Show all	>Lus10033876 pacid=23172828 polypeptide=Lus10033876 locus=Lus10033876.g ID=Lus10033876.BGIv1.0 annot-version=v1.0 MDKLDGGVTSSTPMKISDHLLLPPISSSKPNYNNSPYDRNADIKAFDDTKAGVKGLVDSGVTTIPRLFIHHRTPPTDQYWK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06645			2-oxoglutarate (2OG) and Fe(II...		Lus10033876 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Lus10028043 [exp]	1.4	0.9115
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10009924 [exp]	2.0	0.8586
					Lus10033709 [exp]	5.6	0.7752
					Lus10021816 [exp]	11.5	0.8448
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009399 [exp]	13.0	0.8565
AT1G24590	AP2_ERF	ESR2, DRNL, SOB...	FOR SUPPRESSOR OF PHYTOCHROMEB...		Lus10035076 [exp]	17.7	0.6525
					Lus10013963 [exp]	17.7	0.8274
					Lus10025503 [exp]	20.4	0.8087
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009517 [exp]	23.5	0.8107
AT3G50845			Protein of unknown function (D...		Lus10014311 [exp]	24.2	0.8091

Compare expression of checked genes

Lus10033876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.