Lus10033877 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 223 / 3e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 218 / 2e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G59530 218 / 2e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04380 217 / 4e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 217 / 9e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G43450 214 / 7e-68 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640 210 / 4e-66 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT5G43440 208 / 1e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G03410 208 / 3e-65 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03400 204 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000611 352 / 3e-120 AT1G06620 250 / 7e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10000612 294 / 4e-99 AT5G59540 337 / 2e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10033879 276 / 6e-92 AT5G59540 312 / 8e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10033878 283 / 8e-92 AT5G59540 308 / 4e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10027586 221 / 3e-70 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022189 218 / 2e-69 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022193 217 / 9e-69 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 216 / 2e-68 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017080 209 / 7e-66 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G222300 307 / 4e-104 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 288 / 3e-96 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 283 / 1e-94 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G136000 277 / 2e-92 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 234 / 2e-75 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G083100 233 / 4e-75 AT1G04350 287 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 232 / 1e-74 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 223 / 3e-71 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073166 216 / 1e-68 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 213 / 3e-67 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10033877 pacid=23172743 polypeptide=Lus10033877 locus=Lus10033877.g ID=Lus10033877.BGIv1.0 annot-version=v1.0
ATGGATGGGCTGCTGACAGATAGTCGGAGGTTCCACGAGCTGCCTGGTGAGGAGAAGATGGAGTATTATTCACGTGATCGCTCGCGGCCGGTGAGGTACG
TCAGCAATGGCACACTGCTGACGAGGACGGCGGGGCCTGCTGACTGGAGAGACACGCTGTCTGTCAAAGCTCCCGACGGTCAACTCGACCCTCAATTCTG
CCCTCCTGTATGCAGGAAAGCAGTAACCGATTACTTACAGCAAGTAACAACACTAAATAAGAAGCTATCAGAGCTACTTTCACAAGCTGCAGGGCTAAGT
CGGGACTACTTATCAAGCATCAAATGCATGGAATCAATAGCAATGGTGTGCCATTACTACCCAACTTGTCCCCAGCCCGACCTAACCCTAGGCGTCTCGA
AGCACACCGATCCATATTTTCTCACCATACTCCTTCAAGACTCTACAGGAGGACTCCAAGTCCTCAATCCAAACAACCGCCGATGGGTCGATATGCCTGC
CCCGCGCGGGACCCTGGTGGTGAATATTGGGGATTTCATGCAGCTCATCACCAATGACAAGTTCAAGAGCGTCGAACATCGGGTCAAAGCTTGGAGCTCC
AAGACCCGTTCTTCAATTGCTTGCTTCTTCTCACCGAGCTCCGAGAACATTTCGAAACCTTACAGTCCTGCAGAGGAGATTATCTCTAAGGAGAATACAC
CGGTTTATAGAGCCACACATCTCGCTGAATTTCTGAAATGTTTTAGGTCACATGGCTCCGCACTTTCCCACTTCAGATTGTGCCCGCCCAAGTCCTGA
AA sequence
>Lus10033877 pacid=23172743 polypeptide=Lus10033877 locus=Lus10033877.g ID=Lus10033877.BGIv1.0 annot-version=v1.0
MDGLLTDSRRFHELPGEEKMEYYSRDRSRPVRYVSNGTLLTRTAGPADWRDTLSVKAPDGQLDPQFCPPVCRKAVTDYLQQVTTLNKKLSELLSQAAGLS
RDYLSSIKCMESIAMVCHYYPTCPQPDLTLGVSKHTDPYFLTILLQDSTGGLQVLNPNNRRWVDMPAPRGTLVVNIGDFMQLITNDKFKSVEHRVKAWSS
KTRSSIACFFSPSSENISKPYSPAEEIISKENTPVYRATHLAEFLKCFRSHGSALSHFRLCPPKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10033877 0 1
AT5G36930 Disease resistance protein (TI... Lus10026707 1.0 0.9332
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10029812 2.4 0.7249
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10028996 6.8 0.7367
Lus10014737 9.8 0.7184
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 11.0 0.7184
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 12.0 0.7184
Lus10019558 13.0 0.7184
AT4G16195 Plant self-incompatibility pro... Lus10019768 13.9 0.7184
Lus10021773 14.7 0.7184
AT1G04560 AWPM-19-like family protein (.... Lus10033541 14.9 0.6855

Lus10033877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.