Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024888 [exp] 68 / 5e-15 AT2G36070 445 / 8e-154 translocase inner membrane subunit 44-2 (.1) Lus10003555 [exp] 61 / 6e-14 ND / Lus10039763 [exp] 59 / 6e-13 ND / Lus10018538 [exp] 55 / 2e-11 AT2G35635 51 / 6e-09 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) Lus10033892 [exp] 52 / 9e-11 ND / Lus10039765 [exp] 49 / 2e-09 ND / Lus10039764 [exp] 49 / 3e-09 ND / Lus10039759 [exp] 43 / 8e-07 ND / Lus10018536 [exp] 43 / 9e-07 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G106900 [exp] 72 / 2e-18 ND / Potri.007G117900 [exp] 72 / 2e-18 ND / Potri.007G109600 [exp] 71 / 8e-18 ND / Potri.005G061780 [exp] 70 / 2e-17 ND / Potri.005G224300 [exp] 62 / 1e-14 ND / Potri.002G038350 [exp] 54 / 2e-11 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0187 [flax] [poplar] LysM PF01476 [flax] [poplar] LysM LysM domain
Representative CDS sequence Show only first row Show all	>Lus10033891 pacid=23172797 polypeptide=Lus10033891 locus=Lus10033891.g ID=Lus10033891.BGIv1.0 annot-version=v1.0 ATGGTGAAGAGGGCGCCGTTTGTCCCTGGAGCTTCGGAAGTGGTGTGCGACGTCGTATACGGAGTGGAGGATGGAGACACTTGCTTCTCTGTGGCCAAAT CGTCCAACCTAACCGACTCGGGTTTCTTTCGAATCAACCCTAATCTCAACTGTAACTCCCTTTTCATCGGCCAATGGCTCTGCATCTCTGGCAAAGCATC CCCATAA
AA sequence Show only first row Show all	>Lus10033891 pacid=23172797 polypeptide=Lus10033891 locus=Lus10033891.g ID=Lus10033891.BGIv1.0 annot-version=v1.0 MVKRAPFVPGASEVVCDVVYGVEDGDTCFSVAKSSNLTDSGFFRINPNLNCNSLFIGQWLCISGKASP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033891 [exp]	0	1
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10010863 [exp]	2.6	0.7635
AT1G48120			hydrolases;protein serine/thre...		Lus10005957 [exp]	2.8	0.7558
AT2G45120	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10009278 [exp]	7.7	0.7168
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10027816 [exp]	12.0	0.6445
AT1G07260		UGT71C3	UDP-glucosyl transferase 71C3 ...		Lus10010474 [exp]	13.3	0.6344
AT2G27550		ATC	centroradialis (.1)		Lus10015520 [exp]	17.6	0.6435
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10035275 [exp]	19.5	0.6971
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10035547 [exp]	20.3	0.6435
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016861 [exp]	22.3	0.6616
					Lus10027601 [exp]	26.0	0.6015

Compare expression of checked genes

Lus10033891 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.