Lus10033898 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033357 60 / 3e-12 AT5G09530 61 / 1e-11 proline-rich protein 10, Pro-Glu-Leu|Ile|Val-Pro-Lys 1, hydroxyproline-rich glycoprotein family protein (.1)
Lus10033897 59 / 4e-12 ND 51 / 4e-09
Lus10034812 59 / 5e-12 ND 51 / 7e-09
Lus10033358 60 / 8e-12 ND 57 / 1e-09
Lus10033359 58 / 3e-11 ND 54 / 6e-09
Lus10003550 57 / 5e-11 ND 51 / 1e-08
Lus10034811 52 / 2e-08 AT1G50430 724 / 0.0 PARVA, LEPIDA, DWARF 5, DELTA5,7-STEROL DELTA7 REDUCTASE, Ergosterol biosynthesis ERG4/ERG24 family (.1.2)
Lus10033360 49 / 2e-08 AT4G38080 49 / 5e-08 hydroxyproline-rich glycoprotein family protein (.1)
Lus10034813 42 / 1e-05 AT5G09520 50 / 1e-08 Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033898 pacid=23172819 polypeptide=Lus10033898 locus=Lus10033898.g ID=Lus10033898.BGIv1.0 annot-version=v1.0
ATGGCTTCTTTCAACGGATTCGTACTTGGTCTCTTCATCGCCACCTTTGCATTCTCGAGCTTCAATGTTGGCCTAGCGGCTCGCAATCTCCTCCAGTTGC
CAACGTTGCCACCGATCCCTACCATGATCCCAGCTTTCCCCCAGCCAACCCTGCCTACATTACCACCAATGCCCTCCACAATTCCATCCCTCCCAAAGCC
AACACTGCCAACATTGCCACCAATGCCTAGTCTTCCCCAGCCAACATTACCTACGCTCCCTAAAATTACTACACTGCCCCCACTCCCAAGCATCCCCAAG
GCAACTTTGCCTCCCATGCCCTCCATCCCAGCCATCCCTTCTTTTACCCCACCACCAAGCAACTAA
AA sequence
>Lus10033898 pacid=23172819 polypeptide=Lus10033898 locus=Lus10033898.g ID=Lus10033898.BGIv1.0 annot-version=v1.0
MASFNGFVLGLFIATFAFSSFNVGLAARNLLQLPTLPPIPTMIPAFPQPTLPTLPPMPSTIPSLPKPTLPTLPPMPSLPQPTLPTLPKITTLPPLPSIPK
ATLPPMPSIPAIPSFTPPPSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09530 PRP10, PELPK1 proline-rich protein 10, Pro-G... Lus10033898 0 1
Lus10033358 1.0 0.9659
AT5G04820 OFP ATOFP13, OFP13 ARABIDOPSIS THALIANA OVATE FAM... Lus10043406 3.2 0.9167
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10032857 5.3 0.9156
AT3G07570 Cytochrome b561/ferric reducta... Lus10016080 6.0 0.9277
AT1G72230 Cupredoxin superfamily protein... Lus10027043 6.7 0.9252
AT3G22600 Bifunctional inhibitor/lipid-t... Lus10022065 8.9 0.9136
AT1G55210 Disease resistance-responsive ... Lus10017228 12.8 0.9183
AT3G18400 NAC ANAC058 NAC domain containing protein ... Lus10009029 13.7 0.8955
AT2G38300 GARP myb-like HTH transcriptional r... Lus10002207 14.1 0.9161
AT3G26040 HXXXD-type acyl-transferase fa... Lus10005361 17.7 0.8267

Lus10033898 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.