Lus10033900 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008802 66 / 3e-14 ND /
Lus10029652 67 / 4e-14 ND /
Lus10002224 66 / 5e-14 ND /
Lus10043174 62 / 4e-12 ND /
Lus10032677 57 / 1e-10 ND /
Lus10001380 54 / 3e-10 ND /
Lus10003639 53 / 4e-09 ND /
Lus10013650 49 / 2e-08 ND /
Lus10009741 39 / 0.0004 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033900 pacid=23172756 polypeptide=Lus10033900 locus=Lus10033900.g ID=Lus10033900.BGIv1.0 annot-version=v1.0
ATGGCGAGACAAGAAGCTGTAATAGATAAAGCTCCAATGAAAAACACACCAATGTCCTATGCGAGAAAGAAGGGAAGGAAGAAATCTGGTCACCATTCCT
ACTACCTCAACAAGCGGCTTGACAAAGACCTAACTCCAGAGGAGAACAAGATTGTCACTTACTTTCATTCTGCCTCGGAAGATTGTGTGGAGAACACTGG
ATGGAGGCTGCAACACTTTTTTTGGTGCAAGAAGAAAGACAACGACGACCCCAATGAAGAAGATGGTATGGCGGTTTACGACTACTTGGTCATGAAGAAC
ATTGAGCTTAACGAGATGGTGGAGCTTCTCAATGCTAGGCTGTACAGGTTGGAGCAGGACAGCGACGTCGAAGAGTGGTGGAACAATGGTGACTGGCGTA
GTTCAGCGTAG
AA sequence
>Lus10033900 pacid=23172756 polypeptide=Lus10033900 locus=Lus10033900.g ID=Lus10033900.BGIv1.0 annot-version=v1.0
MARQEAVIDKAPMKNTPMSYARKKGRKKSGHHSYYLNKRLDKDLTPEENKIVTYFHSASEDCVENTGWRLQHFFWCKKKDNDDPNEEDGMAVYDYLVMKN
IELNEMVELLNARLYRLEQDSDVEEWWNNGDWRSSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033900 0 1
AT4G23310 CRK23 cysteine-rich RLK (RECEPTOR-li... Lus10009583 3.9 0.9474
AT4G31920 GARP ARR10 response regulator 10 (.1) Lus10025044 5.3 0.9445
Lus10033901 6.0 0.9444
AT5G06570 alpha/beta-Hydrolases superfam... Lus10008441 7.2 0.9433
AT1G29140 Pollen Ole e 1 allergen and ex... Lus10001895 7.7 0.8898
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Lus10031007 9.2 0.9396
AT5G52170 HD HDG7 homeodomain GLABROUS 7 (.1) Lus10035095 9.8 0.9357
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10002774 10.9 0.9350
AT1G65590 HEXO3, ATHEX1 beta-hexosaminidase 3 (.1) Lus10022251 11.5 0.9113
AT1G71530 Protein kinase superfamily pro... Lus10001470 11.7 0.9338

Lus10033900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.