Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030099 [exp] 99 / 5e-28 ND / Lus10003639 [exp] 94 / 1e-24 ND / Lus10008385 [exp] 89 / 1e-24 ND / Lus10008802 [exp] 82 / 5e-21 ND / Lus10009722 [exp] 84 / 5e-20 AT3G20300 626 / 0.0 Protein of unknown function (DUF3537) (.1) Lus10019381 [exp] 74 / 7e-18 ND / Lus10016935 [exp] 70 / 2e-16 ND / Lus10042626 [exp] 72 / 4e-16 AT1G03840 265 / 3e-85 Magpie, C2H2 and C2HC zinc fingers superfamily protein (.1.2) Lus10022026 [exp] 70 / 8e-16 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G091800 [exp] 47 / 3e-07 AT5G37930 81 / 4e-16 Protein with RING/U-box and TRAF-like domains (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033901 pacid=23172843 polypeptide=Lus10033901 locus=Lus10033901.g ID=Lus10033901.BGIv1.0 annot-version=v1.0 ATGTTGGTACCTACAAAATCTTGGAAGGTCCCCACAAACTATGGTCGTTATCTTGATGCCGACTGTATGAAGGTTGCGCAGTTCAATTGGGGTAAGCATG TGGTGGACATGTTTGTCAAAGAGCTTACTGATTTCGTCCAGGGAAAAACGAAGTCAACATATCCCAATGGGGATATGAACTTCATGGTGTTGCATTTCCT TGATATGGTTCAACTAGATGGCATGTCCTCAAAGGTGACCCTGACATGTGACTATTGGGACCAGGCGAAGGTTTCTGCCTCTTGGAAACAGATAAGGGAA GTATGA
AA sequence Show only first row Show all	>Lus10033901 pacid=23172843 polypeptide=Lus10033901 locus=Lus10033901.g ID=Lus10033901.BGIv1.0 annot-version=v1.0 MLVPTKSWKVPTNYGRYLDADCMKVAQFNWGKHVVDMFVKELTDFVQGKTKSTYPNGDMNFMVLHFLDMVQLDGMSSKVTLTCDYWDQAKVSASWKQIRE V

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033901 [exp]	0	1
AT1G65590		HEXO3, ATHEX1	beta-hexosaminidase 3 (.1)		Lus10022251 [exp]	1.4	0.9811
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	1.4	0.9844
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009003 [exp]	2.8	0.9553
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	3.0	0.9743
AT5G58980			Neutral/alkaline non-lysosomal...		Lus10021829 [exp]	5.5	0.9639
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10042155 [exp]	5.7	0.9458
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	5.7	0.9676
					Lus10033900 [exp]	6.0	0.9444
					Lus10019218 [exp]	6.5	0.9355
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10008441 [exp]	6.7	0.9670

Compare expression of checked genes

Lus10033901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.