Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28530 270 / 7e-89 NAC ANAC074 NAC domain containing protein 74 (.1.2) AT1G56010 199 / 1e-61 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) AT3G12977 192 / 1e-59 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G24430 189 / 7e-58 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT1G76420 186 / 9e-57 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G18400 184 / 4e-56 NAC ANAC058 NAC domain containing protein 58 (.1) AT5G53950 184 / 2e-55 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G61430 180 / 2e-54 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G07680 179 / 4e-54 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT3G15170 179 / 5e-54 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003548 [exp] 361 / 3e-117 AT1G08620 455 / 4e-142 Transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein (.1), Transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein (.2) Lus10022915 [exp] 323 / 1e-110 AT4G28530 274 / 7e-91 NAC domain containing protein 74 (.1.2) Lus10024908 [exp] 223 / 1e-71 AT4G28530 200 / 2e-62 NAC domain containing protein 74 (.1.2) Lus10042466 [exp] 198 / 1e-60 AT1G56010 273 / 9e-90 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Lus10005537 [exp] 184 / 4e-56 AT5G53950 317 / 3e-107 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10009029 [exp] 182 / 1e-54 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10003435 [exp] 181 / 2e-54 AT5G18270 315 / 2e-106 Arabidopsis NAC domain containing protein 87 (.1.2) Lus10009669 [exp] 180 / 5e-54 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1) Lus10026879 [exp] 179 / 2e-53 AT5G18270 325 / 3e-110 Arabidopsis NAC domain containing protein 87 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G225800 [exp] 320 / 2e-109 AT4G28530 270 / 1e-89 NAC domain containing protein 74 (.1.2) Potri.002G037100 [exp] 306 / 3e-104 AT4G28530 276 / 6e-92 NAC domain containing protein 74 (.1.2) Potri.005G098200 [exp] 202 / 3e-63 AT1G56010 332 / 6e-114 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.007G065400 [exp] 202 / 5e-63 AT1G56010 337 / 4e-116 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.002G005800 [exp] 194 / 5e-59 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G255900 [exp] 191 / 9e-58 AT1G76420 295 / 4e-98 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.006G277000 [exp] 185 / 4e-56 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.001G396300 [exp] 184 / 7e-56 AT5G53950 299 / 5e-100 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G056300 [exp] 183 / 1e-55 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1) Potri.015G046800 [exp] 183 / 1e-55 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10033905 pacid=23172738 polypeptide=Lus10033905 locus=Lus10033905.g ID=Lus10033905.BGIv1.0 annot-version=v1.0 ATGATAACTGGGCTGAGAGATATTGGGGCTAGTTTGCCACCAGGGTTCAGGTTCTATCCAAGTGATGAGGAGCTGGTTTGCCATTACCTCTTGAAGAAGA TCTCTGATGATCATCATAACCAAGTCCTCAAGGGCACCCTCGTTGAAATCGACCTCCATACTTGCGAGCCATGGCAGCTCCCCGAGGTGGCGAAGCTGAA CGCGACGGAGTGGTACTTCTTCAGCTTCAGGGACAGGAAGTACGCACCCGGGTTCAGCACCAACCGGGCGACCTTATCCGGCTACTGGAAAGCCACCGGT AAAGATCGGACGGGGGTGGACCCATCCACCAAGGAAATAGTTGGGATGAGGAAGACGCTTGTTTTTTACAGGAACAGAGCTCCCAACGGCACCAAAACTG GGTGGATCATGCACGAGTTCCGACTCGAGTCCCCTCACATGCCCCCTAAAGAGGACTGGGTGCTATGCAGAGTGTTCCACAAAAGCAAAACATCAGAAGA AGAAGAATACAACAACATCAACAAATTCAGCCCACCACCATACCACTTGGTCGACACCACCATCACACATAATTACCATCATACCCCTCCTCCAATCTTG ACCGCTAATTTGCACCCTTCTTCTTTAACGGCTCACAATCATCTTCCCCAGCTTCCCGGACTCACTAATTCCTTATCATCAAGTACTATTACGGCCGCCG CGCAGCCACGTCAGCAGAGCTGTGGTGTACTACTGCCGGCGGCCGGTGGGTCATCGTTGCTGAGTCTACTTCAGGATAACAGCAATAATAACAATCATAG TGAGATCAGCTCTAAACCCAGTAGTAATAATAATAATAATGCAGAAGATCAGTTTGGTTTCTTGTGGGAAGATATGAACTTGGAAGAGACTTCAGATTTT GAAGACATCAGATCATCGTTTGAGATTCATCATCATGACAATATGCTCTTCCTATGA
AA sequence Show only first row Show all	>Lus10033905 pacid=23172738 polypeptide=Lus10033905 locus=Lus10033905.g ID=Lus10033905.BGIv1.0 annot-version=v1.0 MITGLRDIGASLPPGFRFYPSDEELVCHYLLKKISDDHHNQVLKGTLVEIDLHTCEPWQLPEVAKLNATEWYFFSFRDRKYAPGFSTNRATLSGYWKATG KDRTGVDPSTKEIVGMRKTLVFYRNRAPNGTKTGWIMHEFRLESPHMPPKEDWVLCRVFHKSKTSEEEEYNNINKFSPPPYHLVDTTITHNYHHTPPPIL TANLHPSSLTAHNHLPQLPGLTNSLSSSTITAAAQPRQQSCGVLLPAAGGSSLLSLLQDNSNNNNHSEISSKPSSNNNNNAEDQFGFLWEDMNLEETSDF EDIRSSFEIHHHDNMLFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Lus10033905 [exp]	0	1
AT3G14360			alpha/beta-Hydrolases superfam...		Lus10003925 [exp]	3.0	0.8994
AT4G17830			Peptidase M20/M25/M40 family p...		Lus10030957 [exp]	3.7	0.9015
AT2G14095			unknown protein		Lus10010746 [exp]	4.0	0.9101
AT4G33090		ATAPM1, APM1	aminopeptidase M1 (.1)		Lus10025002 [exp]	6.0	0.8812
AT3G52500			Eukaryotic aspartyl protease f...		Lus10004204 [exp]	6.3	0.8553
AT1G13130			Cellulase (glycosyl hydrolase ...		Lus10011403 [exp]	7.1	0.8566
AT1G31550			GDSL-like Lipase/Acylhydrolase...		Lus10024085 [exp]	8.8	0.8807
AT2G43120			RmlC-like cupins superfamily p...		Lus10019561 [exp]	15.7	0.8556
AT3G09920		PIP5K9	phosphatidyl inositol monophos...		Lus10023909 [exp]	16.9	0.8296
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10023048 [exp]	17.3	0.8934

Compare expression of checked genes

Lus10033905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.