Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20490 107 / 7e-33 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022910 [exp] 134 / 1e-42 AT2G20490 107 / 5e-32 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2) Lus10024913 [exp] 132 / 1e-42 AT2G20490 106 / 1e-32 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G226300 [exp] 117 / 9e-37 AT2G20490 115 / 6e-36 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2) Potri.002G036500 [exp] 116 / 1e-36 AT2G20490 116 / 3e-36 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04135 [flax] [poplar] Nop10p Nucleolar RNA-binding protein, Nop10p family
Representative CDS sequence Show only first row Show all	>Lus10033907 pacid=23172881 polypeptide=Lus10033907 locus=Lus10033907.g ID=Lus10033907.BGIv1.0 annot-version=v1.0 ATGTTGCTTCAGTATTACATAAACGATAATGGCGACAAAGTCTACACTACCAAGAAAGAATCGCCGATAGGGTTGGCAACACAGTCTGCTCATCCAGCTC GGTTCTCCCCGGATGACAAATATGCGAGACAAAGGTATCTGTTGAAGAAGCGGTTTGGGCTGCTGCCTACACAGCAACCTCCTCAAAAGTACTGA
AA sequence Show only first row Show all	>Lus10033907 pacid=23172881 polypeptide=Lus10033907 locus=Lus10033907.g ID=Lus10033907.BGIv1.0 annot-version=v1.0 MLLQYYINDNGDKVYTTKKESPIGLATQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQPPQKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10033907 [exp]	0	1
AT5G38890			Nucleic acid-binding, OB-fold-...		Lus10004763 [exp]	1.0	0.8725
AT1G69960		PP2A	serine/threonine protein phosp...		Lus10004252 [exp]	2.4	0.8643
AT1G26880			Ribosomal protein L34e superfa...		Lus10042199 [exp]	4.6	0.8583
AT1G74270			Ribosomal protein L35Ae family...		Lus10035539 [exp]	5.7	0.8117
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	7.3	0.8304
AT4G14000			Putative methyltransferase fam...		Lus10008886 [exp]	7.5	0.7826
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10029320 [exp]	7.5	0.8239
AT3G12390			Nascent polypeptide-associated...		Lus10026133 [exp]	8.5	0.8174
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10006867 [exp]	8.7	0.8327
AT3G19508			unknown protein		Lus10013875 [exp]	10.8	0.7639

Compare expression of checked genes

Lus10033907 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.