Lus10033931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34930 81 / 2e-17 disease resistance family protein / LRR family protein (.1)
AT2G33030 68 / 9e-14 AtRLP25 receptor like protein 25 (.1)
AT5G40170 69 / 1e-13 AtRLP54 receptor like protein 54 (.1)
AT4G13920 68 / 4e-13 AtRLP50 receptor like protein 50 (.1)
AT2G25470 67 / 7e-13 AtRLP21 receptor like protein 21 (.1)
AT1G74190 66 / 1e-12 AtRLP15 receptor like protein 15 (.1)
AT1G74200 66 / 1e-12 AtRLP16 receptor like protein 16 (.1)
AT1G71400 66 / 2e-12 AtRLP12 receptor like protein 12 (.1)
AT1G74180 66 / 2e-12 AtRLP14 receptor like protein 14 (.1)
AT1G58190 66 / 2e-12 AtRLP9 receptor like protein 9 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039512 184 / 1e-53 AT2G15080 379 / 2e-116 receptor like protein 19 (.1.2)
Lus10016325 145 / 9e-42 AT2G34930 206 / 4e-59 disease resistance family protein / LRR family protein (.1)
Lus10002742 145 / 1e-39 AT1G58190 399 / 6e-124 receptor like protein 9 (.1.2)
Lus10002754 109 / 9e-28 AT1G08590 139 / 2e-35 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10039522 106 / 5e-27 AT2G34930 165 / 1e-44 disease resistance family protein / LRR family protein (.1)
Lus10002758 100 / 5e-24 AT2G34930 443 / 1e-140 disease resistance family protein / LRR family protein (.1)
Lus10000236 100 / 5e-24 AT2G34930 328 / 2e-101 disease resistance family protein / LRR family protein (.1)
Lus10016339 98 / 2e-23 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10016337 95 / 2e-22 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G196766 109 / 1e-27 AT2G34930 257 / 7e-76 disease resistance family protein / LRR family protein (.1)
Potri.015G028600 102 / 9e-25 AT2G34930 387 / 1e-119 disease resistance family protein / LRR family protein (.1)
Potri.015G025300 97 / 4e-23 AT2G34930 314 / 1e-91 disease resistance family protein / LRR family protein (.1)
Potri.015G025100 97 / 4e-23 AT2G34930 361 / 3e-109 disease resistance family protein / LRR family protein (.1)
Potri.015G024500 96 / 1e-22 AT2G34930 315 / 7e-92 disease resistance family protein / LRR family protein (.1)
Potri.015G025200 93 / 9e-22 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G024600 93 / 1e-21 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G025800 89 / 2e-20 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1)
Potri.010G107000 88 / 6e-20 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1)
Potri.010G106900 88 / 6e-20 AT2G34930 506 / 1e-164 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10033931 pacid=23154695 polypeptide=Lus10033931 locus=Lus10033931.g ID=Lus10033931.BGIv1.0 annot-version=v1.0
ATGCTCGATTTCAGCGGAAACAAGCTTGTTGGTACAATTCCTGCCTGGATTGGGGAAAAGCTAAGAAACCTGATGATTCTCAACCTGAGGGGAAATAATT
TCCAGGGAAGAATCCCTAAGGAACTATGCAGGGTGAATACCCTCCACGTTTTAGACCTCGCTGACAACAATCTCACTGGAATTATCCCCAGATGCGTCAA
CAACTTCACAGCAATGGTTCGGATGAATGATTCAGGCGGAATCATTCTCGTGAGCGACCCTATTGTGAGGGGAGCCTTATTCGAAAGAGAACTAATTGTG
ATCAAAGGAAAGCTGAATGAGTATGGGTCAATCCTGAAACTGATTCAGCGGCAGAATTCCTTCAAACACACAGATCCAGGGATTTCCTTCCTCAACTTTA
CCGGGAACTTGAATCTATGCGGGCTACCACTTGCGAAGAACTGTAGCTGGGACAATATTGTTGCACCTGGAGGCGATGTAGATGCTAATTCAAGAACCAG
CAAGGAGGAGGAAAGCCAGGAATTCGCGCAGTTGGGGTTTTATGTGAGCATGGGAACAGGGTTCATCGTGAGATTCTGGGGTGTGGTAGGTTCTTTAGGG
CTAAGCAGGAAATGGAGGTGTGAATTCTTTCGGTTTATTGACTCGGCTCGATTTTAA
AA sequence
>Lus10033931 pacid=23154695 polypeptide=Lus10033931 locus=Lus10033931.g ID=Lus10033931.BGIv1.0 annot-version=v1.0
MLDFSGNKLVGTIPAWIGEKLRNLMILNLRGNNFQGRIPKELCRVNTLHVLDLADNNLTGIIPRCVNNFTAMVRMNDSGGIILVSDPIVRGALFERELIV
IKGKLNEYGSILKLIQRQNSFKHTDPGISFLNFTGNLNLCGLPLAKNCSWDNIVAPGGDVDANSRTSKEEESQEFAQLGFYVSMGTGFIVRFWGVVGSLG
LSRKWRCEFFRFIDSARF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34930 disease resistance family prot... Lus10033931 0 1
AT1G69480 EXS (ERD1/XPR1/SYG1) family pr... Lus10019230 1.4 0.8364
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10023363 4.9 0.8107
Lus10007510 8.0 0.7752
AT1G59970 Matrixin family protein (.1) Lus10041294 10.3 0.7191
AT1G04160 XI-B, XI-8, ATX... MYOSIN XI-8, ARABIDOPSIS THALI... Lus10032596 10.5 0.7666
Lus10014474 11.2 0.8031
AT5G10750 Protein of unknown function (D... Lus10020102 12.2 0.7577
AT2G44380 Cysteine/Histidine-rich C1 dom... Lus10037470 13.0 0.7969
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Lus10040255 13.0 0.7812
AT4G20990 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANH... Lus10018017 13.1 0.8236

Lus10033931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.