Lus10033932 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05360 51 / 2e-07 AtRLP30 receptor like protein 30 (.1)
AT3G20820 49 / 4e-07 Leucine-rich repeat (LRR) family protein (.1)
AT2G34930 49 / 6e-07 disease resistance family protein / LRR family protein (.1)
AT3G28890 47 / 5e-06 AtRLP43 receptor like protein 43 (.1.2)
AT5G12940 46 / 7e-06 Leucine-rich repeat (LRR) family protein (.1)
AT5G27060 44 / 3e-05 AtRLP53 receptor like protein 53 (.1)
AT3G12610 43 / 8e-05 DRT100 DNA-DAMAGE REPAIR/TOLERATION 100, Leucine-rich repeat (LRR) family protein (.1)
AT1G71400 43 / 0.0001 AtRLP12 receptor like protein 12 (.1)
AT1G54470 42 / 0.0002 RPP27 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2)
AT1G74180 42 / 0.0002 AtRLP14 receptor like protein 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039512 174 / 2e-50 AT2G15080 379 / 2e-116 receptor like protein 19 (.1.2)
Lus10039529 98 / 1e-23 AT2G34930 427 / 1e-134 disease resistance family protein / LRR family protein (.1)
Lus10016324 77 / 3e-16 AT4G20140 268 / 9e-78 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Lus10039531 76 / 6e-16 AT2G34930 485 / 2e-156 disease resistance family protein / LRR family protein (.1)
Lus10016344 72 / 1e-14 AT2G34930 399 / 1e-124 disease resistance family protein / LRR family protein (.1)
Lus10016339 70 / 9e-14 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10016340 67 / 7e-13 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1)
Lus10002742 66 / 3e-12 AT1G58190 399 / 6e-124 receptor like protein 9 (.1.2)
Lus10016338 64 / 1e-11 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G196832 69 / 2e-13 AT2G34930 203 / 8e-57 disease resistance family protein / LRR family protein (.1)
Potri.012G034600 68 / 3e-13 AT2G34930 434 / 1e-137 disease resistance family protein / LRR family protein (.1)
Potri.001G027500 66 / 1e-12 AT2G34930 130 / 1e-33 disease resistance family protein / LRR family protein (.1)
Potri.010G106900 66 / 1e-12 AT2G34930 506 / 1e-164 disease resistance family protein / LRR family protein (.1)
Potri.015G028600 66 / 1e-12 AT2G34930 387 / 1e-119 disease resistance family protein / LRR family protein (.1)
Potri.010G107000 66 / 2e-12 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1)
Potri.015G024600 63 / 2e-11 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G025200 63 / 2e-11 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G025800 61 / 7e-11 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1)
Potri.015G024500 61 / 1e-10 AT2G34930 315 / 7e-92 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Lus10033932 pacid=23154757 polypeptide=Lus10033932 locus=Lus10033932.g ID=Lus10033932.BGIv1.0 annot-version=v1.0
ATGTCTCGCATCACCCTGTTCTTCAGACCACCTGCAGCGTTAATAATCCTGATGATCATCATCCTTCCATCCAGCAATGGCTCACTGTCAACTCTCACAC
CAGACTGCCGACCTACAGAGAGGAAAGCTCTTCTTCAGTTCAAGCAACATCATCTCGTTGACTTCTCGGGTCACCTCGACTCTTGGTCAGCTGACAGCGG
AGACTGCTGCAGAACATGGTCAGGAGTTGTCTGTGACAACGTCACTGGATATGTACTTGACCTTCATCTTGGTTATGAACTTGATAACCTGTCAAAACTC
GCGATCCCGGATCTCATAGTTATTGACGTTCAAGTCCTGAGTCTAGATTGGGTTTCTAGTCTCACTTCCTTGGAAATCTTACGCCTCGATTTCCTGGACC
TCAGTAAACTTTCGAATTCTTGGCTAGATGCCACAAGTAAGCTCCCTTCGCTTGTCGAATTGCGCCTCCCAAATTGCGGAATTATTCAGGTTCCGCCGCT
CCTGAACCCTGTCATTTTCTCGTCTTCAATATCTGTTCTTGATTTGTCTTGCAACAATTCTCTGGTCAACCTTCATTCTCCAACTGGATTCTTCATCTCA
AGTCCTTAA
AA sequence
>Lus10033932 pacid=23154757 polypeptide=Lus10033932 locus=Lus10033932.g ID=Lus10033932.BGIv1.0 annot-version=v1.0
MSRITLFFRPPAALIILMIIILPSSNGSLSTLTPDCRPTERKALLQFKQHHLVDFSGHLDSWSADSGDCCRTWSGVVCDNVTGYVLDLHLGYELDNLSKL
AIPDLIVIDVQVLSLDWVSSLTSLEILRLDFLDLSKLSNSWLDATSKLPSLVELRLPNCGIIQVPPLLNPVIFSSSISVLDLSCNNSLVNLHSPTGFFIS
SP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G20820 Leucine-rich repeat (LRR) fami... Lus10033932 0 1
AT2G18180 Sec14p-like phosphatidylinosit... Lus10028332 3.2 0.9088
Lus10010253 8.9 0.8731
AT5G10530 Concanavalin A-like lectin pro... Lus10020452 9.2 0.8229
AT1G79690 ATNUDT3 nudix hydrolase homolog 3 (.1) Lus10024090 10.0 0.9005
Lus10027774 10.8 0.8708
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10036818 15.1 0.8879
Lus10032670 20.5 0.8844
AT4G28320 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl ... Lus10039719 20.8 0.8659
AT1G22130 MADS AGL104 AGAMOUS-like 104 (.1) Lus10022506 21.4 0.8854
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10010482 24.1 0.8790

Lus10033932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.