Lus10033937 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53300 300 / 2e-106 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT4G27960 298 / 5e-106 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT1G64230 296 / 5e-105 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT3G08690 293 / 4e-104 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G41700 293 / 6e-104 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G56150 279 / 2e-98 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 274 / 2e-96 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 250 / 5e-87 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 164 / 2e-52 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 151 / 1e-47 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032352 305 / 1e-108 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10039323 300 / 1e-106 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 300 / 1e-106 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 300 / 1e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 300 / 1e-106 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 293 / 7e-104 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 293 / 8e-104 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 293 / 8e-104 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027846 286 / 6e-101 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G033000 303 / 5e-108 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 303 / 5e-108 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 301 / 3e-107 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.003G136200 300 / 2e-106 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 298 / 7e-106 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.006G110200 298 / 9e-106 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 296 / 4e-105 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 290 / 1e-102 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.011G168200 290 / 2e-102 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 286 / 2e-101 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10033937 pacid=23154815 polypeptide=Lus10033937 locus=Lus10033937.g ID=Lus10033937.BGIv1.0 annot-version=v1.0
ATGGCTTCCAAGCGGATCTTGAAGGAGCTCAAGGATCTCCAGAAAGACCCTCCTACCTCCTGCAGCGCAGGTCCTGTCGCTGAAGACATGTTCCATTGGC
AAGCAACGATTATGGGCCCTCCTGATAGCCCATATGCCGGTGGAGTGTTTCTAGTCAGTATTCACTTCCCACCAGACTATCCATTCAAGCCACCAAAGGT
TGCTTTCAGGACAAAGGTATTCCACCCCAATATCAACAGCAACGGTAGCATCTGCCTGGATATTCTCAAAGAGCAGTGGAGCCCGGCTTTAACCATCTCA
AAGGTGTTGCTGTCCATTTGCTCCCTCTTGACGGACCCCAACCCCGATGACCCCTTGGTCCCTGAGATTGCCCACATGTACAAAACCGATAAGAACAAGT
ACGAAACAACCGCGAGCAGCTGGACTCAGAAGTATGCTATGGGCTAA
AA sequence
>Lus10033937 pacid=23154815 polypeptide=Lus10033937 locus=Lus10033937.g ID=Lus10033937.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYETTASSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Lus10033937 0 1
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Lus10032352 1.0 0.8913
AT2G02760 ATUBC2 ubiquitin-conjugating enzyme 2... Lus10036727 1.4 0.8801
AT4G37830 cytochrome c oxidase-related (... Lus10011574 9.9 0.8397
AT4G15470 Bax inhibitor-1 family protein... Lus10021950 10.2 0.8397
AT1G03910 unknown protein Lus10027605 10.9 0.8367
AT3G47550 RING/FYVE/PHD zinc finger supe... Lus10035010 13.4 0.8176
AT3G24100 Uncharacterised protein family... Lus10016668 13.6 0.8252
AT5G14540 Protein of unknown function (D... Lus10032138 14.5 0.8607
AT5G01960 RING/U-box superfamily protein... Lus10011027 15.7 0.8354
AT5G18110 NCBP novel cap-binding protein (.1) Lus10005704 15.7 0.8571

Lus10033937 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.