Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06410 106 / 7e-30 DNAJ heat shock N-terminal domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016189 [exp] 145 / 1e-44 AT5G06410 205 / 2e-65 DNAJ heat shock N-terminal domain-containing protein (.1) Lus10029359 [exp] 142 / 2e-43 AT5G06410 265 / 6e-89 DNAJ heat shock N-terminal domain-containing protein (.1) Lus10026975 [exp] 119 / 5e-37 AT5G06410 100 / 2e-27 DNAJ heat shock N-terminal domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G200900 [exp] 113 / 3e-32 AT5G06410 253 / 3e-84 DNAJ heat shock N-terminal domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10033940 pacid=23154821 polypeptide=Lus10033940 locus=Lus10033940.g ID=Lus10033940.BGIv1.0 annot-version=v1.0 ATGCATCCACTCGAAAAAAAAGTGGAAAAGTTAAAATGTGCAATCCAGCCAGTGGATCGCTCTCTGAACTACTTCCGATTATTTGGACTAGAGAAGAAGT ATGAGATCGAGGATGATAATTTGTACGATAAGTATAAAGACTGGCAGAAGAAGTTGCATCCTGATTTGGTTCATTCCAAGTCTGAGAAGGAGAGGGAGTT TGCTCGAGAGCAGTCGGCTCGAGTTGGGGATGCGTATCGCACTCTGGCCAAATCTTCGGATTAG
AA sequence Show only first row Show all	>Lus10033940 pacid=23154821 polypeptide=Lus10033940 locus=Lus10033940.g ID=Lus10033940.BGIv1.0 annot-version=v1.0 MHPLEKKVEKLKCAIQPVDRSLNYFRLFGLEKKYEIEDDNLYDKYKDWQKKLHPDLVHSKSEKEREFAREQSARVGDAYRTLAKSSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06410			DNAJ heat shock N-terminal dom...		Lus10033940 [exp]	0	1
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10005634 [exp]	4.2	0.7505
AT1G48360			zinc ion binding;nucleic acid ...		Lus10037442 [exp]	11.0	0.7449
AT3G24530			AAA-type ATPase family protein...		Lus10005293 [exp]	11.8	0.7866
					Lus10017219 [exp]	16.3	0.7715
AT5G45275			Major facilitator superfamily ...		Lus10033280 [exp]	17.5	0.7795
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10038317 [exp]	20.6	0.6385
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031270 [exp]	24.2	0.7621
AT4G24690		AtNBR1	Arabidopsis thaliana next to B...		Lus10019471 [exp]	30.4	0.6858
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	36.5	0.7510
AT3G48010		ATCNGC16	cyclic nucleotide-gated channe...		Lus10042132 [exp]	37.5	0.7312

Compare expression of checked genes

Lus10033940 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.