Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023092 [exp] 84 / 2e-21 ND 42 / 6e-04 Lus10007827 [exp] 56 / 2e-11 AT1G69550 43 / 4e-05 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10007822 [exp] 52 / 2e-09 AT4G11170 86 / 7e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10000423 [exp] 47 / 6e-08 AT1G27180 338 / 5e-95 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10040576 [exp] 47 / 1e-07 AT1G27180 355 / 3e-103 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10007829 [exp] 46 / 2e-07 AT5G36930 330 / 2e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007831 [exp] 46 / 2e-07 AT1G27180 332 / 7e-96 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10007823 [exp] 44 / 1e-06 AT1G27170 322 / 3e-92 transmembrane receptors;ATP binding (.1.2) Lus10004747 [exp] 44 / 1e-06 AT5G36930 342 / 3e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033952 pacid=23154812 polypeptide=Lus10033952 locus=Lus10033952.g ID=Lus10033952.BGIv1.0 annot-version=v1.0 ATGGATAGTATATATTTGGATTTGAAGGGATTCAACAACTTGATTGACGTTGATTCTGATCTTTCGCCCCTCACCACCGAAGGGGCCGGTCTAGGTAAAC TTGAAGTAACCATCTACTGGCCACAACAATATTCACGGGCACCTTTTAAGAGACCACTTCCAGAGCAAGACGATTCAAACAAGTTTTACTGA
AA sequence Show only first row Show all	>Lus10033952 pacid=23154812 polypeptide=Lus10033952 locus=Lus10033952.g ID=Lus10033952.BGIv1.0 annot-version=v1.0 MDSIYLDLKGFNNLIDVDSDLSPLTTEGAGLGKLEVTIYWPQQYSRAPFKRPLPEQDDSNKFY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10033952 [exp]	0	1
AT5G47510			Sec14p-like phosphatidylinosit...		Lus10028938 [exp]	2.6	0.9401
AT5G18970			AWPM-19-like family protein (....		Lus10001116 [exp]	5.8	0.9377
AT5G36930			Disease resistance protein (TI...		Lus10008526 [exp]	6.0	0.9292
AT5G02140			Pathogenesis-related thaumatin...		Lus10003962 [exp]	7.7	0.9071
AT1G76040		CPK29	calcium-dependent protein kina...		Lus10017251 [exp]	10.8	0.9155
AT1G79430	GARP	WDY, APL	WOODY, ALTERED PHLOEM DEVELOPM...		Lus10001844 [exp]	11.0	0.9242
AT5G20870			O-Glycosyl hydrolases family 1...		Lus10043075 [exp]	13.2	0.9220
AT4G23410		TET5	tetraspanin5 (.1)		Lus10041411 [exp]	13.9	0.8925
AT1G71692	MADS	XAL1, AGL12	XAANTAL1, AGAMOUS-like 12 (.1)		Lus10009472 [exp]	14.9	0.8664
AT4G27960		UBC9	ubiquitin conjugating enzyme 9...		Lus10005072 [exp]	16.0	0.9158

Compare expression of checked genes

Lus10033952 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.