Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11050 129 / 5e-36 ATGH9C3 glycosyl hydrolase 9C3 (.1) AT1G64390 126 / 2e-35 ATGH9C2 glycosyl hydrolase 9C2 (.1) AT1G48930 77 / 8e-18 ATGH9C1 glycosyl hydrolase 9C1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032377 [exp] 202 / 3e-63 AT1G64390 989 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10003888 [exp] 169 / 1e-50 AT1G64390 960 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10001833 [exp] 153 / 6e-45 AT1G64390 965 / 0.0 glycosyl hydrolase 9C2 (.1) Lus10017402 [exp] 75 / 7e-17 AT1G48930 746 / 0.0 glycosyl hydrolase 9C1 (.1) Lus10010201 [exp] 72 / 9e-16 AT1G48930 812 / 0.0 glycosyl hydrolase 9C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G139600 [exp] 139 / 9e-40 AT1G64390 999 / 0.0 glycosyl hydrolase 9C2 (.1) Potri.001G092200 [exp] 138 / 2e-39 AT1G64390 951 / 0.0 glycosyl hydrolase 9C2 (.1) Potri.007G071200 [exp] 79 / 2e-18 AT1G48930 850 / 0.0 glycosyl hydrolase 9C1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0203 [flax] [poplar] CBD PF09478 [flax] [poplar] CBM49 Carbohydrate binding domain CBM49
Representative CDS sequence Show only first row Show all	>Lus10033956 pacid=23154891 polypeptide=Lus10033956 locus=Lus10033956.g ID=Lus10033956.BGIv1.0 annot-version=v1.0 ATGTCGAATTTCGGTTCGATTTCTAACTCTGCACCTATTGCAATCAAGCAAAAGGTGACAACTTCCTGGAACCACCAAGGGAAAACCTACTACAGATACT CAGCCATAGTGACCAACTACTCACCAAAGCCACTGAACAACATCAAGCTTTACATCAACAAGCTCTACGGTCCCATCTGGGGGCTGACCAAGTACGGAAA CTCGTACGGTTTCCCAGCATGGATCAAGTCTCTACCAGCTGGGAAAAGCATGGAATTCGTCTACATTCATACTGCTCCTTATGCAGACGTCTCTGTTTCT ACCTACACATTGGCCTGA
AA sequence Show only first row Show all	>Lus10033956 pacid=23154891 polypeptide=Lus10033956 locus=Lus10033956.g ID=Lus10033956.BGIv1.0 annot-version=v1.0 MSNFGSISNSAPIAIKQKVTTSWNHQGKTYYRYSAIVTNYSPKPLNNIKLYINKLYGPIWGLTKYGNSYGFPAWIKSLPAGKSMEFVYIHTAPYADVSVS TYTLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G11050		ATGH9C3	glycosyl hydrolase 9C3 (.1)		Lus10033956 [exp]	0	1
AT1G64390		ATGH9C2	glycosyl hydrolase 9C2 (.1)		Lus10033957 [exp]	2.4	0.8683
AT2G01420		PIN4, ATPIN4	ARABIDOPSIS PIN-FORMED 4, Auxi...		Lus10020830 [exp]	3.5	0.8616
AT1G08770		PRA1.E	prenylated RAB acceptor 1.E (....		Lus10018774 [exp]	4.6	0.8955
AT3G26935			DHHC-type zinc finger family p...		Lus10035177 [exp]	4.9	0.8499
AT1G70280			NHL domain-containing protein ...		Lus10039484 [exp]	6.9	0.8343
AT4G02290		ATGH9B13	glycosyl hydrolase 9B13 (.1)		Lus10010307 [exp]	7.7	0.8527
AT2G01420		PIN4, ATPIN4	ARABIDOPSIS PIN-FORMED 4, Auxi...		Lus10020829 [exp]	10.0	0.8153
AT2G01940	C2H2ZnF	SGR5, ATIDD15	SHOOT GRAVITROPISM 5, ARABIDOP...		Lus10031882 [exp]	15.5	0.8077
AT3G27580		D6PKL3, ATPK7	D6 PROTEIN KINASE LIKE 3, Prot...		Lus10002518 [exp]	16.0	0.8534
AT5G48460			Actin binding Calponin homolog...		Lus10038235 [exp]	19.5	0.8154

Compare expression of checked genes

Lus10033956 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.