Lus10033959 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16640 234 / 1e-79 TCTP translationally controlled tumor protein (.1)
AT3G05540 227 / 5e-77 Methionine sulfoxide reductase (MSS4-like) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002877 303 / 6e-107 AT3G16640 256 / 2e-88 translationally controlled tumor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G221200 251 / 1e-86 AT3G16640 228 / 2e-77 translationally controlled tumor protein (.1)
Potri.010G013400 245 / 4e-84 AT3G16640 217 / 5e-73 translationally controlled tumor protein (.1)
Potri.005G024800 243 / 3e-83 AT3G16640 284 / 8e-100 translationally controlled tumor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0080 Beta-tent PF00838 TCTP Translationally controlled tumour protein
Representative CDS sequence
>Lus10033959 pacid=23154688 polypeptide=Lus10033959 locus=Lus10033959.g ID=Lus10033959.BGIv1.0 annot-version=v1.0
ATGTTGGTCTACGAGGATCTTGTTACCGGTGATGAGCTTCTCTCTGACTCATTCCCCTACAACGAAATTCTGGATGGAGCTTTGTGGGAAGTTGAGGGAA
AGTGGGTTGTTCAAGGAGCCGTTGATGTGAACATTGGTGCCAACCCTTCTGCTGAAGGAGCTGATGAAGATGAGGGTGTTGATGACCAGGCTGCTAAGGT
AGTTGACATTGTCGACACCTTTAGACTCCAGGAGCAACCGGCCTTTGACAAGAAACAGTTTGTCACATACATTAAGAGATACATCAAGGCCTTGACAGCT
AAGTTGGACGATGAGCAGAAGGAAAAATTCAAGAAGAACATTGAGGCAGCAACTAAGTACCTCCTCTCCAAGCTCAGCGACCTCCAGTTTTTCGTCGGTG
AGAGCATGAAGGATGATGCCACTCTGGTGTTTGCTTACTACAAGGATGGTGCCGCAGACCCGACATTTCTGTACCTCCCCCAGGCTTTGAAGGAGGTCAA
GTGCTAG
AA sequence
>Lus10033959 pacid=23154688 polypeptide=Lus10033959 locus=Lus10033959.g ID=Lus10033959.BGIv1.0 annot-version=v1.0
MLVYEDLVTGDELLSDSFPYNEILDGALWEVEGKWVVQGAVDVNIGANPSAEGADEDEGVDDQAAKVVDIVDTFRLQEQPAFDKKQFVTYIKRYIKALTA
KLDDEQKEKFKKNIEAATKYLLSKLSDLQFFVGESMKDDATLVFAYYKDGAADPTFLYLPQALKEVKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16640 TCTP translationally controlled tum... Lus10033959 0 1
AT3G16640 TCTP translationally controlled tum... Lus10002877 1.4 0.9459
AT3G19130 ATRBP47B RNA-binding protein 47B (.1) Lus10014029 2.0 0.9205
Lus10010420 7.6 0.7796
AT5G04000 unknown protein Lus10042034 8.1 0.8189
AT5G22060 ATJ2 ARABIDOPSIS THALIANA DNAJ HOMO... Lus10008652 8.9 0.8114
AT5G27720 LSM4, EMB1644 SM-like protein 4, embryo defe... Lus10004221 8.9 0.8535
AT1G26750 unknown protein Lus10016383 10.4 0.8191
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10017822 13.1 0.8578
AT5G53045 unknown protein Lus10017942 15.1 0.8405
AT4G04614 unknown protein Lus10014685 16.7 0.7935

Lus10033959 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.