Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18540 102 / 9e-29 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002878 [exp] 144 / 1e-45 AT5G18540 121 / 5e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G216700 [exp] 109 / 2e-31 AT5G18540 141 / 3e-43 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10033960 pacid=23154859 polypeptide=Lus10033960 locus=Lus10033960.g ID=Lus10033960.BGIv1.0 annot-version=v1.0 ATGGAAGAGCTGAGCGAAGAAGAAAGGAAAGCTCTGAGAGGAAGCAAATTCGCGCCTCTTCCTCCTCCTTCTTCCCGCTCTAACAACTCCAGGTTGGCAC ACCCTGGGGGACCGTTGAAGACTAACAAAGCAGCGGCACTTGCCAAGTTCCTGGAGAGGAAGCTTCAGGAGCCTAACGGCCTAGACTCCCTCAACCCCGA TCTCCTTGAGTTGGCCGTTAAGAACGCCAAGAAAACTGTCTCTTCCGGTGCAGGTTTCACTCCTCTCGTTGTTTTCATTCATTTCTTTTTTAGAAGAGTT GAGATCGCTTCTTTGAAGTTGAGATGTATTGGAACAGCAGCTTGA
AA sequence Show only first row Show all	>Lus10033960 pacid=23154859 polypeptide=Lus10033960 locus=Lus10033960.g ID=Lus10033960.BGIv1.0 annot-version=v1.0 MEELSEEERKALRGSKFAPLPPPSSRSNNSRLAHPGGPLKTNKAAALAKFLERKLQEPNGLDSLNPDLLELAVKNAKKTVSSGAGFTPLVVFIHFFFRRV EIASLKLRCIGTAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18540			unknown protein		Lus10033960 [exp]	0	1
AT1G67420			Zn-dependent exopeptidases sup...		Lus10037015 [exp]	4.8	0.8426
AT3G07590			Small nuclear ribonucleoprotei...		Lus10028022 [exp]	9.7	0.8357
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Lus10011877 [exp]	14.2	0.8325
AT4G37280			MRG family protein (.1)		Lus10019312 [exp]	14.3	0.7828
AT5G13340			unknown protein		Lus10035960 [exp]	17.5	0.8198
AT1G44910		ATPRP40A	pre-mRNA-processing protein 40...		Lus10007723 [exp]	18.5	0.8206
AT5G08420			RNA-binding KH domain-containi...		Lus10026187 [exp]	19.6	0.8206
AT3G20190			Leucine-rich repeat protein ki...		Lus10033339 [exp]	24.8	0.8034
AT3G59800			unknown protein		Lus10008338 [exp]	25.0	0.7961
AT4G24940		ATSAE1A, AT-SAE...	SUMO-activating enzyme 1A (.1)		Lus10028846 [exp]	25.2	0.8207

Compare expression of checked genes

Lus10033960 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.