Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18600 149 / 4e-48 Thioredoxin superfamily protein (.1) AT4G15690 148 / 4e-48 Thioredoxin superfamily protein (.1) AT4G15680 146 / 2e-47 Thioredoxin superfamily protein (.1) AT4G15670 144 / 2e-46 Thioredoxin superfamily protein (.1) AT4G15700 144 / 3e-46 Thioredoxin superfamily protein (.1) AT4G15660 141 / 4e-45 Thioredoxin superfamily protein (.1) AT3G21460 127 / 2e-39 Glutaredoxin family protein (.1) AT1G03020 123 / 6e-38 Thioredoxin superfamily protein (.1) AT3G62930 122 / 7e-38 Thioredoxin superfamily protein (.1) AT3G62950 120 / 4e-37 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002887 [exp] 206 / 8e-71 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 124 / 2e-38 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10040898 [exp] 119 / 2e-36 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 119 / 2e-36 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 120 / 4e-36 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 115 / 1e-34 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10029441 [exp] 111 / 3e-33 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 111 / 3e-33 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1) Lus10029440 [exp] 104 / 2e-30 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G021800 [exp] 160 / 1e-52 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 156 / 3e-51 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 156 / 5e-51 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 134 / 3e-42 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.002G208700 [exp] 128 / 4e-40 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.014G134000 [exp] 128 / 7e-40 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 128 / 1e-39 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 127 / 2e-39 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 127 / 4e-39 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 115 / 4e-35 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10033965 pacid=23154699 polypeptide=Lus10033965 locus=Lus10033965.g ID=Lus10033965.BGIv1.0 annot-version=v1.0 ATGGAAAGAGTGGCGCAATTGGCGGCGGAGAGGCCGGTGGTGATGTTCAGCAGGAGCACGTGCTGCATGTGCCACTCCATCAAGACACTCTTCTGCGACT TCGGAGTCAACCCCACCATCTACGAGCTCGACCTGATCCCCGGTGGCCGCGAAATCGAGCAGGCCCTTGCTCGCCTAGGAGCCACCACAGTCCCGACCGT CTTCATCGGCGGGGAACTCGTCGGTGGCGCTAATGAGGTCATGACCCTCCACCTTAACGGCTCCTTATCCGGCATGCTTAGACGCGCCGGCGCATTGTGG CTCTGA
AA sequence Show only first row Show all	>Lus10033965 pacid=23154699 polypeptide=Lus10033965 locus=Lus10033965.g ID=Lus10033965.BGIv1.0 annot-version=v1.0 MERVAQLAAERPVVMFSRSTCCMCHSIKTLFCDFGVNPTIYELDLIPGGREIEQALARLGATTVPTVFIGGELVGGANEVMTLHLNGSLSGMLRRAGALW L

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18600			Thioredoxin superfamily protei...		Lus10033965 [exp]	0	1
AT4G15690			Thioredoxin superfamily protei...		Lus10002887 [exp]	1.7	0.9358
AT3G21460			Glutaredoxin family protein (....		Lus10012815 [exp]	2.0	0.9233
AT2G22330		CYP79B3	"cytochrome P450, family 79, s...		Lus10000239 [exp]	3.0	0.8856
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10015843 [exp]	4.9	0.9170
AT1G10380			Putative membrane lipoprotein ...		Lus10037237 [exp]	5.0	0.9027
AT1G78410			VQ motif-containing protein (....		Lus10038502 [exp]	7.5	0.8908
AT1G24620			EF hand calcium-binding protei...		Lus10007816 [exp]	8.7	0.9119
AT1G23550		SRO2	similar to RCD one 2 (.1)		Lus10013012 [exp]	12.0	0.8920
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Lus10017668 [exp]	13.0	0.8685
AT3G57120			Protein kinase superfamily pro...		Lus10029721 [exp]	13.4	0.8653

Compare expression of checked genes

Lus10033965 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.