Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18800 181 / 6e-61 Cox19-like CHCH family protein (.1.2) AT3G06310 177 / 4e-59 Cox19-like CHCH family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012784 [exp] 215 / 2e-74 AT5G18800 181 / 9e-61 Cox19-like CHCH family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G196600 [exp] 189 / 6e-64 AT5G18800 190 / 2e-64 Cox19-like CHCH family protein (.1.2) Potri.010G026000 [exp] 184 / 6e-62 AT5G18800 192 / 3e-65 Cox19-like CHCH family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF06747 [flax] [poplar] CHCH CHCH domain
Representative CDS sequence Show only first row Show all	>Lus10033991 pacid=23154834 polypeptide=Lus10033991 locus=Lus10033991.g ID=Lus10033991.BGIv1.0 annot-version=v1.0 ATGGCTAGTGCTTCGGTGGATGATTCGGGAAATCCGATCCCAACATCGGCGGTGCTGATGTCGGCGTCAAAGCACATTGGGCAGAGATGCTTTGAAGAGA ATGTAGCGTTCATCAAGTGTAAGAAGCAGGATCCTAACCCTGAGAAATGCCTCGATAAAGGCCGCCAAGTCACTAGCTGCGTTTTGGGCCTGCTGAAAGA TCTTCACGAGAGGTGCACGAAAGAAATGGATGATTACGTTGGCTGCATGTACTACAATACAAATGAGTTTGATCTGTGCCGCAAAGAGCAGCAGGCGTTT GAGAAGAAATGCCCTCTGTAG
AA sequence Show only first row Show all	>Lus10033991 pacid=23154834 polypeptide=Lus10033991 locus=Lus10033991.g ID=Lus10033991.BGIv1.0 annot-version=v1.0 MASASVDDSGNPIPTSAVLMSASKHIGQRCFEENVAFIKCKKQDPNPEKCLDKGRQVTSCVLGLLKDLHERCTKEMDDYVGCMYYNTNEFDLCRKEQQAF EKKCPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18800			Cox19-like CHCH family protein...		Lus10033991 [exp]	0	1
AT4G20150			unknown protein		Lus10036250 [exp]	1.0	0.9289
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Lus10023733 [exp]	5.2	0.9208
AT5G53650			unknown protein		Lus10008848 [exp]	6.0	0.9066
AT5G23535			KOW domain-containing protein ...		Lus10042614 [exp]	6.7	0.9163
AT5G20500			Glutaredoxin family protein (....		Lus10017148 [exp]	7.2	0.9185
AT4G28360			Ribosomal protein L22p/L17e fa...		Lus10006865 [exp]	9.3	0.9265
AT5G67590		FRO1	FROSTBITE1, NADH-ubiquinone ox...		Lus10011547 [exp]	9.5	0.9036
AT3G22110		PAC1	20S proteasome alpha subunit C...		Lus10004235 [exp]	12.2	0.9067
AT1G04850			ubiquitin-associated (UBA)/TS-...		Lus10037827 [exp]	13.0	0.9136
AT1G05205			unknown protein		Lus10039669 [exp]	13.9	0.8973

Compare expression of checked genes

Lus10033991 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.