Lus10033992 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012783 44 / 4e-06 AT5G18810 39 / 2e-04 SC35-like splicing factor 28 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10033992 pacid=23154738 polypeptide=Lus10033992 locus=Lus10033992.g ID=Lus10033992.BGIv1.0 annot-version=v1.0
ATGCCGAGGTACCGGAGTCGTAGCAGGAGCTACAGCCCTCGTCGCCGCAGCAGAACTCCGCCTCGTCTCCGCAAGCGCAACGACGATGACGTCGATGAAC
CTCGTGATCGATTCCGTGACAGTCGCTCCCACAGAGACCGTCGCTCTCCTGCTCCTTCTGGTTTGCTCGTCCGCAATCTCCCTATGGACGCTAGGACGGG
GATGATTTTCTCACATCAGGGAACATTTTTCTTTGCAGCTTCCTCACGCTCTGCTTCACCCTCTAGGAATGACACAAGGGATCGTGGTGTGAAGGATGAC
TACCGTTCTTCACGTAGATCTAGATCTCTTTCAAGATCGTACTCTCCACTGGATGAGAAGGAGCACAAGTCTAACCAGAGATCTCCAAGCCCAGTAGAAA
ATGGCCGCAGCCCTCAAGATGTCAGGGAGAATCCATCTCGTAGATCAATAAGTTGTGCTTGGCGTGGCTGTTCTATTTTCTTCACTGGCCGTTGA
AA sequence
>Lus10033992 pacid=23154738 polypeptide=Lus10033992 locus=Lus10033992.g ID=Lus10033992.BGIv1.0 annot-version=v1.0
MPRYRSRSRSYSPRRRSRTPPRLRKRNDDDVDEPRDRFRDSRSHRDRRSPAPSGLLVRNLPMDARTGMIFSHQGTFFFAASSRSASPSRNDTRDRGVKDD
YRSSRRSRSLSRSYSPLDEKEHKSNQRSPSPVENGRSPQDVRENPSRRSISCAWRGCSIFFTGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10033992 0 1
AT5G64200 ATSC35, At-SC35 ARABIDOPSIS THALIANA ORTHOLOG ... Lus10003957 4.9 0.8278
AT3G53540 unknown protein Lus10025296 10.3 0.8308
AT5G03870 Glutaredoxin family protein (.... Lus10021353 16.5 0.8342
AT3G04680 CLPS3 CLP-similar protein 3 (.1.2) Lus10007269 20.1 0.7739
AT5G57120 unknown protein Lus10001434 30.7 0.7893
AT1G31335 unknown protein Lus10038328 31.9 0.8168
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10004366 52.3 0.8000
AT5G57410 Afadin/alpha-actinin-binding p... Lus10019997 55.0 0.8009
AT1G05730 Eukaryotic protein of unknown ... Lus10025588 63.4 0.7405
AT5G38690 Zinc-finger domain of monoamin... Lus10017575 69.9 0.7939

Lus10033992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.