Lus10033997 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18850 93 / 1e-25 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G026900 105 / 9e-31 AT5G18850 101 / 1e-29 unknown protein
Potri.008G197300 103 / 6e-30 AT5G18850 110 / 3e-33 unknown protein
PFAM info
Representative CDS sequence
>Lus10033997 pacid=23154650 polypeptide=Lus10033997 locus=Lus10033997.g ID=Lus10033997.BGIv1.0 annot-version=v1.0
ATGGCATCGCCGGCAGCTAAGATGGCGTTCCGTGTGGTGGTAGCAGTGATGGTGATAACAGTAGTGTTCTACGTGGGTCGTCCATTGTACTGGAAGATCT
CGGCCACCGTCCAAGAGATCCGCGAAAACAAGCGCACCGTCAAGCAAGGGATTTCGCAGATCGTTTACGAAGCGCAGAAATCGGTGGGGTGGTTCCACGA
CGAGTCCGATCCGGGGGTGGTGCGGCGGGCCACTAATCGGAAGCTGCTTCTGCTAGTCGAGAGAGACATCAGTGCGAATTCTACTAAAGGTCCCGGCCGT
GAACTCCAAATAAGCTCCCAGCTGCAAGTCGTGACCTCGAGCTGCCATATGATCAGCGGATCTCCCAGTCCCTCTCCCGGGGTCTCTGGAATTTAG
AA sequence
>Lus10033997 pacid=23154650 polypeptide=Lus10033997 locus=Lus10033997.g ID=Lus10033997.BGIv1.0 annot-version=v1.0
MASPAAKMAFRVVVAVMVITVVFYVGRPLYWKISATVQEIRENKRTVKQGISQIVYEAQKSVGWFHDESDPGVVRRATNRKLLLLVERDISANSTKGPGR
ELQISSQLQVVTSSCHMISGSPSPSPGVSGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18850 unknown protein Lus10033997 0 1
AT1G67350 unknown protein Lus10037020 1.0 0.9053
AT3G63110 ATIPT3 isopentenyltransferase 3 (.1) Lus10012372 1.7 0.8884
AT5G28490 OBO2, LSH1 ORGAN BOUNDARY 2, LIGHT-DEPEND... Lus10042565 3.2 0.8947
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10011053 4.6 0.8631
AT2G01620 MEE11 maternal effect embryo arrest ... Lus10007930 5.7 0.8852
AT1G61600 Protein of unknown function (D... Lus10035379 7.1 0.8850
AT1G08315 ARM repeat superfamily protein... Lus10039500 7.5 0.8706
AT2G31160 OBO1, LSH3 ORGAN BOUNDARY 1, LIGHT SENSIT... Lus10022918 8.7 0.8699
AT4G02730 AtWDR5b human WDR5 \(WD40 repeat\) hom... Lus10014674 8.8 0.8706
AT3G22550 Protein of unknown function (D... Lus10010568 9.9 0.8724

Lus10033997 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.