Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18920 85 / 1e-23 Cox19-like CHCH family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G198500 [exp] 95 / 2e-27 AT5G18920 90 / 2e-25 Cox19-like CHCH family protein (.1) Potri.010G028000 [exp] 90 / 1e-25 AT5G18920 88 / 7e-25 Cox19-like CHCH family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034006 pacid=23154661 polypeptide=Lus10034006 locus=Lus10034006.g ID=Lus10034006.BGIv1.0 annot-version=v1.0 ATGGGCATGGCCGAATCCAAGCCGACGGAGAAACCTTCACAGCCGCCACCGCCGCCGGTTCACCAGGACGACGCTGACGAGGAAGACGAGAGCGTCAAGC AACTCAGAGAATGCTCCTCCGTCTACCTTTCCCTGCAGGATTGTCTCGTGAATACAGACAGGAATTGGAAAGCTTGTCAAAAGGAGGTCCAAGCTTTAAA GGCGTGCAATGAGAGGAGGAAGGAACATACCCAACAAGGGAAATGA
AA sequence Show only first row Show all	>Lus10034006 pacid=23154661 polypeptide=Lus10034006 locus=Lus10034006.g ID=Lus10034006.BGIv1.0 annot-version=v1.0 MGMAESKPTEKPSQPPPPPVHQDDADEEDESVKQLRECSSVYLSLQDCLVNTDRNWKACQKEVQALKACNERRKEHTQQGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18920			Cox19-like CHCH family protein...		Lus10034006 [exp]	0	1
AT1G11340			S-locus lectin protein kinase ...		Lus10018406 [exp]	7.2	0.8911
AT5G37850		SOS4, ATSOS4	SALT OVERLY SENSITIVE 4, pfkB-...		Lus10000451 [exp]	13.7	0.8777
AT2G48010		RKF3	receptor-like kinase in in flo...		Lus10029626 [exp]	14.1	0.8868
AT4G36740	HD	HB-5, ATHB40	homeobox protein 40 (.1)		Lus10041719 [exp]	20.9	0.8816
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Lus10016998 [exp]	27.1	0.8775
AT5G05550	Trihelix		sequence-specific DNA binding ...		Lus10028985 [exp]	30.9	0.8741
AT1G76690		OPR2, ATOPR2	ARABIDOPSIS 12-OXOPHYTODIENOAT...		Lus10013218 [exp]	32.9	0.8760
AT5G49760			Leucine-rich repeat protein ki...		Lus10007587 [exp]	41.6	0.8731
AT1G27900			RNA helicase family protein (....		Lus10015812 [exp]	44.0	0.8604
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10037268 [exp]	44.5	0.8737

Compare expression of checked genes

Lus10034006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.