Lus10034007 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G396800 59 / 7e-11 AT3G07870 99 / 2e-22 F-box and associated interaction domains-containing protein (.1)
Potri.011G137200 58 / 2e-10 AT3G07870 94 / 1e-20 F-box and associated interaction domains-containing protein (.1)
Potri.008G216223 48 / 4e-07 AT3G07870 93 / 4e-21 F-box and associated interaction domains-containing protein (.1)
Potri.008G215901 45 / 5e-06 AT3G07870 103 / 3e-24 F-box and associated interaction domains-containing protein (.1)
Potri.008G215800 45 / 5e-06 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0162 FBA PF07734 FBA_1 F-box associated
Representative CDS sequence
>Lus10034007 pacid=23154739 polypeptide=Lus10034007 locus=Lus10034007.g ID=Lus10034007.BGIv1.0 annot-version=v1.0
ATGAAGGAGTACGGGGAAGATTCTTGGACCAAACATTTTGTGATTGGGAACTTGCCTCTTGGCGTAAGGAACTTGGCTCCTTTAGTGTTTTCCAACAACG
GGAAGAAGGCCTTGATGATGTGCGACGAATCACGAGTTTACAAGGTAGTCCAAACCTATGACCCGATTGACAAAGATCGCGATGATGATGATGTGCCGGT
GGCTGAAGTCTATACACTTGGTACTGGTCAATGGAGAAGCATTGGCAATGCACTTGCCTCTGTTAAGAATGCTTCCTCATCCTATAACACTTCCCTGCAT
TCATCGGTTCATTGGATTGGCTCGAGTAAAGAACGCACGAAAGATTCACTCTTCTGTTTCGAATTTGAGAAAGAAGAGTTTAGGGAGCTGCCTTCACCAC
CTCATTCAGCGAACTGTGTTTCCACCAAGTTGGGAGTTTTGAATGGCTGTCTTTCTGCAGGTTTCTCACTCAACTGA
AA sequence
>Lus10034007 pacid=23154739 polypeptide=Lus10034007 locus=Lus10034007.g ID=Lus10034007.BGIv1.0 annot-version=v1.0
MKEYGEDSWTKHFVIGNLPLGVRNLAPLVFSNNGKKALMMCDESRVYKVVQTYDPIDKDRDDDDVPVAEVYTLGTGQWRSIGNALASVKNASSSYNTSLH
SSVHWIGSSKERTKDSLFCFEFEKEEFRELPSPPHSANCVSTKLGVLNGCLSAGFSLN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06240 F-box family protein (.1) Lus10034007 0 1
Lus10039495 4.1 0.7327
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10031478 6.3 0.7070
AT4G14103 F-box/RNI-like superfamily pro... Lus10020634 7.2 0.6868
AT4G14103 F-box/RNI-like superfamily pro... Lus10020635 8.1 0.6892
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10041082 13.2 0.6699
AT3G51070 S-adenosyl-L-methionine-depend... Lus10025976 19.0 0.6313
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10014056 20.6 0.6687
AT3G53710 AGD6 ARF-GAP domain 6 (.1.2) Lus10012991 21.8 0.6687
Lus10002332 23.0 0.6687
AT3G05950 RmlC-like cupins superfamily p... Lus10023351 24.1 0.6687

Lus10034007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.