Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23610 167 / 5e-54 DSPTP1 dual specificity protein phosphatase 1 (.1.2.3) AT3G06110 161 / 5e-52 DSPTP1B, MKP2, ATMKP2 DUAL-SPECIFICITY PROTEIN PHOSPHATASE 1B, ARABIDOPSIS MAPK PHOSPHATASE 2, MAPK phosphatase 2 (.1.2.3) AT5G23720 86 / 1e-20 PHS1 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) AT3G55270 82 / 4e-19 MKP1, ATMKP1 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) AT2G04550 71 / 7e-16 DSPTP1E, IBR5 DUAL SPECIFICITY PROTEIN PHOSPHATASE 1E, indole-3-butyric acid response 5 (.1.3) AT5G56610 53 / 2e-09 Phosphotyrosine protein phosphatases superfamily protein (.1.2) AT2G35680 45 / 2e-06 Phosphotyrosine protein phosphatases superfamily protein (.1) AT3G09100 44 / 6e-06 mRNA capping enzyme family protein (.1.2) AT5G01290 42 / 2e-05 mRNA capping enzyme family protein (.1) AT5G28210 38 / 0.0008 mRNA capping enzyme family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021940 [exp] 164 / 8e-53 AT3G23610 248 / 1e-84 dual specificity protein phosphatase 1 (.1.2.3) Lus10041227 [exp] 155 / 4e-49 AT3G23610 237 / 4e-80 dual specificity protein phosphatase 1 (.1.2.3) Lus10032545 [exp] 87 / 1e-20 AT5G23720 1120 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Lus10043195 [exp] 86 / 2e-20 AT5G23720 1047 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Lus10036877 [exp] 81 / 1e-18 AT3G23610 511 / 3e-171 dual specificity protein phosphatase 1 (.1.2.3) Lus10003291 [exp] 81 / 1e-18 AT3G55270 800 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) Lus10006229 [exp] 81 / 1e-18 AT3G23610 512 / 1e-171 dual specificity protein phosphatase 1 (.1.2.3) Lus10030324 [exp] 80 / 2e-18 AT3G55270 806 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) Lus10022402 [exp] 76 / 3e-17 AT4G18593 147 / 2e-43 dual specificity protein phosphatase-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G033000 [exp] 173 / 2e-56 AT3G23610 249 / 4e-85 dual specificity protein phosphatase 1 (.1.2.3) Potri.015G105000 [exp] 92 / 1e-22 AT5G23720 1096 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Potri.012G105800 [exp] 90 / 6e-22 AT5G23720 1006 / 0.0 PROPYZAMIDE-HYPERSENSITIVE 1, dual specificity protein phosphatase family protein (.1.2.3) Potri.008G049900 [exp] 83 / 2e-19 AT3G55270 710 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) Potri.010G210900 [exp] 83 / 2e-19 AT3G55270 715 / 0.0 ARABIDOPSIS MITOGEN-ACTIVATED PROTEIN KINASE PHOSPHATASE 1, mitogen-activated protein kinase phosphatase 1 (.1) Potri.016G035700 [exp] 79 / 2e-18 AT4G18593 149 / 3e-44 dual specificity protein phosphatase-related (.1) Potri.006G040300 [exp] 77 / 9e-18 AT4G18593 148 / 5e-44 dual specificity protein phosphatase-related (.1) Potri.014G160500 [exp] 64 / 4e-13 AT2G04550 333 / 6e-116 DUAL SPECIFICITY PROTEIN PHOSPHATASE 1E, indole-3-butyric acid response 5 (.1.3) Potri.014G045500 [exp] 55 / 8e-10 AT2G35680 360 / 2e-124 Phosphotyrosine protein phosphatases superfamily protein (.1) Potri.002G136700 [exp] 54 / 3e-09 AT2G35680 350 / 1e-120 Phosphotyrosine protein phosphatases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00782 [flax] [poplar] DSPc Dual specificity phosphatase, catalytic domain
Representative CDS sequence Show only first row Show all	>Lus10034033 pacid=23154691 polypeptide=Lus10034033 locus=Lus10034033.g ID=Lus10034033.BGIv1.0 annot-version=v1.0 ATGAAGGACGCACTCAAACGCGCCAATGTAACTCACATCTTAACCGTTGCCAGCATCCTGCCTTCTTTTCCAGAGCAATTTCAATACAAGCTCTTAAACA TTACGGACAGCCTAAACACAGACATAGCAAGATACTTTGATGAATGTTTCAACTTTATTGATGAATCTAAAAGACTTGGTGGTGGTGTGCTTGTACATTG CTTTATGGGAGTTTCCAGAAGTGTGACGGTTGTTGTTGCTTACCTGATGAAGAAGCGTCATATGACCTTATCTCAGGCATTGCAGCATGTTCAGAGTAGG AGACCTCAGGCCTCTCCCAATCCCGGATTCATTTCACAACTACGAAAATTAGAACAGACTCTTCAAGGTGAATCTTAG
AA sequence Show only first row Show all	>Lus10034033 pacid=23154691 polypeptide=Lus10034033 locus=Lus10034033.g ID=Lus10034033.BGIv1.0 annot-version=v1.0 MKDALKRANVTHILTVASILPSFPEQFQYKLLNITDSLNTDIARYFDECFNFIDESKRLGGGVLVHCFMGVSRSVTVVVAYLMKKRHMTLSQALQHVQSR RPQASPNPGFISQLRKLEQTLQGES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10034033 [exp]	0	1
AT1G20225			Thioredoxin superfamily protei...		Lus10021843 [exp]	46.2	0.5163
AT2G22120			RING/FYVE/PHD zinc finger supe...		Lus10016426 [exp]	55.4	0.5124
AT5G12180		CPK17	calcium-dependent protein kina...		Lus10038460 [exp]	66.0	0.4885
					Lus10008679 [exp]	119.5	0.4233
AT5G44150			unknown protein		Lus10014193 [exp]	173.5	0.4034

Compare expression of checked genes

Lus10034033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.