Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034034 pacid=23154658 polypeptide=Lus10034034 locus=Lus10034034.g ID=Lus10034034.BGIv1.0 annot-version=v1.0 ATGACGCTTCTTCATCAGGCTGTCCGTAACTGCCAAGGAAGTTCGCATCAAACAAGTTCAAAGGATCATCATCATCATAAGCTCTTTGGAAAACAAACGA AGCACATTCCTCGAAACTTAGATTCTACCCCAGAATGTAAAACAAACAACCAAATTACGTAG
AA sequence Show only first row Show all	>Lus10034034 pacid=23154658 polypeptide=Lus10034034 locus=Lus10034034.g ID=Lus10034034.BGIv1.0 annot-version=v1.0 MTLLHQAVRNCQGSSHQTSSKDHHHHKLFGKQTKHIPRNLDSTPECKTNNQIT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034034 [exp]	0	1
AT2G25010			Aminotransferase-like, plant m...		Lus10003764 [exp]	6.6	0.6546
AT5G40250			RING/U-box superfamily protein...		Lus10008797 [exp]	9.3	0.6546
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	13.0	0.6131
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	15.0	0.6131
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Lus10042071 [exp]	16.3	0.5525
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	16.7	0.6131
AT5G04885			Glycosyl hydrolase family prot...		Lus10005706 [exp]	18.2	0.6063
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	18.3	0.6131
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	19.8	0.6131
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10005599 [exp]	20.7	0.6068

Compare expression of checked genes

Lus10034034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.