Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G19151 57 / 2e-12 unknown protein AT3G52420 35 / 0.0008 ATOEP7 outer envelope membrane protein 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003733 [exp] 44 / 6e-07 AT3G52420 68 / 5e-17 outer envelope membrane protein 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G203800 [exp] 70 / 1e-17 AT5G19151 54 / 2e-11 unknown protein Potri.002G054700 [exp] 41 / 4e-06 AT3G52420 49 / 1e-09 outer envelope membrane protein 7 (.1) Potri.005G208100 [exp] 40 / 9e-06 AT3G52420 52 / 2e-10 outer envelope membrane protein 7 (.1) Potri.017G127350 [exp] 37 / 0.0002 AT3G52420 53 / 4e-11 outer envelope membrane protein 7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034040 pacid=23154765 polypeptide=Lus10034040 locus=Lus10034040.g ID=Lus10034040.BGIv1.0 annot-version=v1.0 ATGGGTTCCCAAGATACACAGGTCGTTTTATGTGGCGACGGCGGGGTATGGAGGGAAGGAAGGAAGGGAAAGATGAAGGCAGAAACGAAGCTGAACGCGA TCAGATCAGGGCTGGTGGTATTAGGCGCTTTGGCTTTCGGATATCTAACAATTGAGATCGGCTTCAAACCTTTTATCCTCAAAGCCCAAGAAGAGGAGCG CCAGAAACAACAACTACAACCTCTTCCTTCCGATGATAATTCCCCATCCCACGAATCCTACTAA
AA sequence Show only first row Show all	>Lus10034040 pacid=23154765 polypeptide=Lus10034040 locus=Lus10034040.g ID=Lus10034040.BGIv1.0 annot-version=v1.0 MGSQDTQVVLCGDGGVWREGRKGKMKAETKLNAIRSGLVVLGALAFGYLTIEIGFKPFILKAQEEERQKQQLQPLPSDDNSPSHESY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G19151			unknown protein		Lus10034040 [exp]	0	1
AT4G14600			Target SNARE coiled-coil domai...		Lus10041130 [exp]	1.4	0.7695
AT1G05780			Vacuolar ATPase assembly integ...		Lus10018982 [exp]	4.5	0.7019
AT3G07568			unknown protein		Lus10016081 [exp]	4.7	0.7490
					Lus10030382 [exp]	5.5	0.7453
AT5G28910			unknown protein		Lus10027959 [exp]	6.3	0.7333
AT3G18110		EMB1270	embryo defective 1270, Pentatr...		Lus10013785 [exp]	10.2	0.7171
AT5G09920		NRPB4, ATRPB15....	RNA polymerase II, Rpb4, core ...		Lus10005796 [exp]	14.0	0.7323
AT4G21720			unknown protein		Lus10017512 [exp]	17.2	0.7087
AT3G57930			unknown protein		Lus10031233 [exp]	19.0	0.6758
AT5G11900			Translation initiation factor ...		Lus10013512 [exp]	30.0	0.6761

Compare expression of checked genes

Lus10034040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.