Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54870 95 / 2e-25 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT3G05260 92 / 2e-24 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004471 [exp] 96 / 1e-25 AT1G54870 501 / 5e-180 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10029937 [exp] 95 / 2e-25 AT1G54870 503 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10033745 [exp] 82 / 2e-20 AT1G54870 365 / 8e-127 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10021931 [exp] 79 / 2e-19 AT3G05260 364 / 3e-127 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024360 [exp] 37 / 0.0002 AT5G06060 287 / 7e-98 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10015821 [exp] 37 / 0.0002 AT1G24360 427 / 5e-148 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10036980 [exp] 37 / 0.0003 AT1G24360 437 / 3e-155 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10042181 [exp] 37 / 0.0003 AT2G47130 255 / 3e-85 short-chain dehydrogenase/reductase 2, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10010874 [exp] 36 / 0.0006 AT5G06060 295 / 8e-101 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G023900 [exp] 94 / 2e-25 AT1G54870 493 / 1e-177 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.010G092400 [exp] 83 / 7e-22 AT1G54870 301 / 3e-103 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.008G149201 [exp] 82 / 6e-21 AT1G54870 378 / 3e-132 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.013G050700 [exp] 49 / 8e-09 AT1G54870 182 / 5e-57 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.019G023900 [exp] 45 / 2e-07 AT1G54870 172 / 1e-52 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.012G105700 [exp] 39 / 6e-05 AT2G47140 251 / 9e-84 short-chain dehydrogenase reductase 5, NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.015G065700 [exp] 37 / 0.0002 AT2G47140 248 / 1e-82 short-chain dehydrogenase reductase 5, NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.015G104800 [exp] 36 / 0.0003 AT2G47140 243 / 2e-80 short-chain dehydrogenase reductase 5, NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.014G145800 [exp] 35 / 0.0007 AT3G26760 348 / 8e-121 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.002G236700 [exp] 35 / 0.0009 AT3G26760 342 / 2e-118 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034047 pacid=23154805 polypeptide=Lus10034047 locus=Lus10034047.g ID=Lus10034047.BGIv1.0 annot-version=v1.0 ATGAAGGAAGGAAGCAGCATCATCAATTTGACATCCGTGAATGCCTACGCTGGAGGTTCCGAGGTGCTGGATTACACAGCAACCAAAGGAAACATTGTTG CCTTCACTAGAGGTTTGGCCCTGCAGCTTGTGAGCAAGGGGATCCGAGTCAATGCGGTGGCTTCGGGACCAGTCTAG
AA sequence Show only first row Show all	>Lus10034047 pacid=23154805 polypeptide=Lus10034047 locus=Lus10034047.g ID=Lus10034047.BGIv1.0 annot-version=v1.0 MKEGSSIINLTSVNAYAGGSEVLDYTATKGNIVAFTRGLALQLVSKGIRVNAVASGPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G54870			NAD(P)-binding Rossmann-fold s...		Lus10034047 [exp]	0	1
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10014406 [exp]	4.5	0.9435
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Lus10026188 [exp]	7.5	0.9258
					Lus10042590 [exp]	9.6	0.8495
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10004652 [exp]	9.9	0.9172
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	11.0	0.9170
					Lus10036765 [exp]	12.2	0.9170
AT2G16190			unknown protein		Lus10011284 [exp]	13.4	0.9170
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Lus10032010 [exp]	14.5	0.9028
AT3G54200			Late embryogenesis abundant (L...		Lus10031554 [exp]	14.5	0.9170
					Lus10006395 [exp]	15.5	0.9170

Compare expression of checked genes

Lus10034047 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.