Lus10034054 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06035 212 / 3e-70 Glycoprotein membrane precursor GPI-anchored (.1)
AT5G19250 211 / 7e-70 Glycoprotein membrane precursor GPI-anchored (.1)
AT1G54860 145 / 5e-44 Glycoprotein membrane precursor GPI-anchored (.1)
AT5G19240 144 / 1e-43 Glycoprotein membrane precursor GPI-anchored (.1)
AT5G19230 131 / 1e-38 Glycoprotein membrane precursor GPI-anchored (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010516 318 / 6e-112 AT3G06035 226 / 9e-76 Glycoprotein membrane precursor GPI-anchored (.1)
Lus10004470 135 / 3e-40 AT1G54860 190 / 2e-61 Glycoprotein membrane precursor GPI-anchored (.1)
Lus10029938 136 / 7e-37 AT1G08960 640 / 0.0 cation calcium exchanger 5, Arabidopsis thaliana cation calcium exchanger 5, cation exchanger 11 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G195000 248 / 3e-84 AT3G06035 231 / 2e-77 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.010G033400 243 / 1e-82 AT3G06035 214 / 4e-71 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.005G034400 147 / 7e-45 AT1G54860 167 / 6e-53 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.013G023801 112 / 5e-32 AT1G54860 102 / 4e-28 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.005G034200 94 / 3e-24 AT1G54860 110 / 2e-30 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.005G034300 82 / 3e-19 AT1G54860 99 / 5e-26 Glycoprotein membrane precursor GPI-anchored (.1)
Potri.013G023701 60 / 8e-12 AT1G54860 62 / 8e-13 Glycoprotein membrane precursor GPI-anchored (.1)
PFAM info
Representative CDS sequence
>Lus10034054 pacid=23154670 polypeptide=Lus10034054 locus=Lus10034054.g ID=Lus10034054.BGIv1.0 annot-version=v1.0
ATGCCGTCATCTTCAAGGCTTCCCCTTTTCCTCCTTGCTTCCTTCCTCATCTCTGCTCTTCTCTTCATTGACCCTGTTCGCTGTGATGATGAAGATGATA
AGCTTCTTCAAGGCATCAACGACTACAGAAGAAGCTTGAACCTGACCTCCCTAACGGAGAACGACAATGCAGAATGCCTTGCTGGCGAAATAGCCGATCA
ATTCAAGGGTCAACCTTGCACCAACACCACAGGAGCCAACACTGTGCCTGGAACCGAGCCTCAGCTTCCCAACTACCCGAGCCTCCTGGTCAAATGCCAT
TTGAATGTCTCCAACACCAGGGATGGAGCTGTAATGCCTGCCTGTGTTCCCAACCTTGACCCGGCTCTCGTGCTTTCTAACTTCACCATGAGCCAGTACT
CTGACAATCTGAATGACACCAAGTATACAGGAGTCGGCATTGGTACTGAAGGTGACTGGATTGTCGTTGTTCTCTCCACCAGCACTCCTGATGGAAGCTT
TGCCACTTACAAAGGAGGAGAATCAGCCGGTGGTGGTATGAGGACTGCAACCGGTCTGACTTCTCCATTGCTGCTGCTTCTGCTGGTGGCATCTCTACTT
CTGCTGTAA
AA sequence
>Lus10034054 pacid=23154670 polypeptide=Lus10034054 locus=Lus10034054.g ID=Lus10034054.BGIv1.0 annot-version=v1.0
MPSSSRLPLFLLASFLISALLFIDPVRCDDEDDKLLQGINDYRRSLNLTSLTENDNAECLAGEIADQFKGQPCTNTTGANTVPGTEPQLPNYPSLLVKCH
LNVSNTRDGAVMPACVPNLDPALVLSNFTMSQYSDNLNDTKYTGVGIGTEGDWIVVVLSTSTPDGSFATYKGGESAGGGMRTATGLTSPLLLLLLVASLL
LL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06035 Glycoprotein membrane precurso... Lus10034054 0 1
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Lus10036886 2.2 0.9426
AT5G03690 Aldolase superfamily protein (... Lus10035571 2.4 0.9396
AT3G06035 Glycoprotein membrane precurso... Lus10010516 2.6 0.9240
AT2G16230 O-Glycosyl hydrolases family 1... Lus10023576 2.8 0.9234
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10012162 2.8 0.9416
AT1G29470 S-adenosyl-L-methionine-depend... Lus10018954 4.9 0.9118
AT1G72790 hydroxyproline-rich glycoprote... Lus10006024 5.7 0.9050
AT1G26570 UGD1, ATUGD1 UDP-glucose dehydrogenase 1 (.... Lus10037096 6.9 0.9317
AT5G66060 2-oxoglutarate (2OG) and Fe(II... Lus10028404 7.1 0.8996
AT3G29360 UGD2 UDP-glucose dehydrogenase 2, U... Lus10036887 7.1 0.9317

Lus10034054 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.