Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040026 [exp] 172 / 5e-57 AT1G48120 45 / 3e-06 hydrolases;protein serine/threonine phosphatases (.1) Lus10012087 [exp] 172 / 2e-55 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10000686 [exp] 163 / 2e-52 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003272 [exp] 158 / 2e-50 ND 39 / 0.002 Lus10024265 [exp] 159 / 1e-49 AT1G17930 59 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10008255 [exp] 154 / 8e-46 AT1G48120 49 / 1e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10017181 [exp] 127 / 1e-38 ND / Lus10007197 [exp] 124 / 2e-38 ND / Lus10015702 [exp] 126 / 7e-38 ND 38 / 0.004
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10034059 pacid=23154635 polypeptide=Lus10034059 locus=Lus10034059.g ID=Lus10034059.BGIv1.0 annot-version=v1.0 ATGGTTCGACAAGAGCGTAGGGCAGGAGAGGCGTTAGCTGGTAGGTGGGACAGTGCAGAGACACCTTGTCGTGGTGGCGGGGTCCTACGAGAGAGGTTGG ACTACTATCGGCGCCTCCTCGATAACATGGATTCCCATGATGTGAGTTGGCTTCCTTTTGGGCCGCATCCCGACCTTGAGGTCCCCGTGTCGACTTTCTG TGGTCTCATCCATTGCGGTGACGTAGGTGAGTACTACGATTCCTATCGTGTACTCCGACAGTTTGGGTACACACAGGTGGTCCCTCACTCGATTCCTGTG TCGCTACGGGCCATTAGGCCCAAATCTATCCGGACCTATGCGGTCTAG
AA sequence Show only first row Show all	>Lus10034059 pacid=23154635 polypeptide=Lus10034059 locus=Lus10034059.g ID=Lus10034059.BGIv1.0 annot-version=v1.0 MVRQERRAGEALAGRWDSAETPCRGGGVLRERLDYYRRLLDNMDSHDVSWLPFGPHPDLEVPVSTFCGLIHCGDVGEYYDSYRVLRQFGYTQVVPHSIPV SLRAIRPKSIRTYAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G48120			hydrolases;protein serine/thre...		Lus10034059 [exp]	0	1

Compare expression of checked genes

Lus10034059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.