Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16023 50 / 2e-10 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 (.1) AT3G02493 48 / 1e-09 DVL2, RTFL19, DVL12 DEVIL 2, ROTUNDIFOLIA like 19 (.1) AT1G67265 45 / 2e-08 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1) AT3G25717 41 / 7e-07 RTFL16, DVL6 DEVIL 6, ROTUNDIFOLIA like 16 (.1) AT1G13245 41 / 7e-07 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1) AT3G18518 36 / 6e-05 RTFL20, DVL7 DEVIL 7, ROTUNDIFOLIA like 20 (.1) AT1G68825 35 / 0.0001 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT1G64585 35 / 0.0002 RTFL22, DVL12 DEVIL 12, ROTUNDIFOLIA like 22 (.1) AT3G55515 35 / 0.0003 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT2G39705 35 / 0.0004 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003079 [exp] 70 / 6e-18 AT5G16023 55 / 3e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1) Lus10034272 [exp] 44 / 6e-08 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 39 / 6e-06 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10023399 [exp] 35 / 0.0005 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G102950 [exp] 51 / 7e-11 AT1G67265 64 / 4e-16 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.017G112100 [exp] 50 / 1e-10 AT1G67265 62 / 1e-15 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.008G116700 [exp] 41 / 8e-07 AT1G13245 76 / 6e-21 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.010G129600 [exp] 40 / 1e-06 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.010G201700 [exp] 35 / 0.0002 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G057800 [exp] 35 / 0.0003 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.014G138900 [exp] 34 / 0.0006 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.002G173750 [exp] 34 / 0.0007 AT1G64585 44 / 3e-08 DEVIL 12, ROTUNDIFOLIA like 22 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [flax] [poplar] DVL DVL family
Representative CDS sequence Show only first row Show all	>Lus10034071 pacid=23154801 polypeptide=Lus10034071 locus=Lus10034071.g ID=Lus10034071.BGIv1.0 annot-version=v1.0 ATGAGGAGGACAAGCAGTGAAATGAGCAGCGTATCTTCATCTTCATCGTCTTCGTCGAAGAAAAGGGTGATATCTTGCGGAAGGCTGGGGAGGTATCTAA AGCAGCAACAAGGACGGCTCTACATCATCAAGAGATGCGTTGTCATCCTGCTCTGTTCCCGCGACTGA
AA sequence Show only first row Show all	>Lus10034071 pacid=23154801 polypeptide=Lus10034071 locus=Lus10034071.g ID=Lus10034071.BGIv1.0 annot-version=v1.0 MRRTSSEMSSVSSSSSSSSKKRVISCGRLGRYLKQQQGRLYIIKRCVVILLCSRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16023		RTFL18, DVL1	DEVIL 1, ROTUNDIFOLIA like 18 ...		Lus10034071 [exp]	0	1
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Lus10027862 [exp]	10.7	0.9961
AT3G44540		FAR4	fatty acid reductase 4 (.1.2)		Lus10019187 [exp]	15.7	0.9941
AT3G19950			RING/U-box superfamily protein...		Lus10017722 [exp]	16.9	0.8921
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032263 [exp]	19.2	0.9939
AT3G21720		ICL	isocitrate lyase (.1)		Lus10031552 [exp]	22.3	0.9939
AT2G24180		CYP71B6	cytochrome p450 71b6 (.1)		Lus10017697 [exp]	24.1	0.9938
					Lus10009206 [exp]	27.4	0.9938
AT1G16510			SAUR-like auxin-responsive pro...		Lus10018269 [exp]	28.2	0.9059
AT2G19110		ATHMA4, HMA4	ARABIDOPSIS HEAVY METAL ATPASE...		Lus10006956 [exp]	29.6	0.9938
					Lus10032770 [exp]	30.8	0.9480

Compare expression of checked genes

Lus10034071 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.