Lus10034073 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38650 197 / 3e-66 Proteasome maturation factor UMP1 (.1)
AT1G67250 197 / 4e-66 Proteasome maturation factor UMP1 (.1)
AT5G38660 198 / 5e-63 APE1 acclimation of photosynthesis to environment (.1.2)
AT1G62920 0 / 1 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003077 265 / 4e-93 AT5G38660 193 / 1e-64 acclimation of photosynthesis to environment (.1.2)
Lus10005377 60 / 2e-12 AT5G38650 54 / 2e-10 Proteasome maturation factor UMP1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G111900 185 / 2e-61 AT1G67250 187 / 2e-62 Proteasome maturation factor UMP1 (.1)
Potri.006G249600 183 / 2e-60 AT1G67250 186 / 7e-62 Proteasome maturation factor UMP1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05348 UMP1 Proteasome maturation factor UMP1
Representative CDS sequence
>Lus10034073 pacid=23154896 polypeptide=Lus10034073 locus=Lus10034073.g ID=Lus10034073.BGIv1.0 annot-version=v1.0
ATGGAAGGAGCACCCAAGACGATAGCGCACGAAGCCGGAGCAATCGAGAAGGATCCACTTCGATTCGGCCTCCATGGCGTTAAAAGCGACCTCGTCGGAT
CTCACCCTCTCCAAGCTTCATATGGATCCACTATTAAAACTCACGAAGACATGAAGAGGAGAGTCCTTGCAAACACTTACGGATTTGCCTTCCCTGTGAA
GATGGACCTGGAAAGACAAATTCTTACCCGATTTCAGAGACCAGCAGGTGCTATTCCTTCTTCAATGCTTGGATTGGAAGCCATGACTGGTAGCTTGGAT
GATTTTGGTTTCGAGGATTATCTTAATGATCCTCGTGAATCTGAAGTCTATCGACCAGTGGACATGCACCATGGGTTGGAGGTTCACCTGGCACTGTCCA
AGGGACCGGTTCAAGGTTCTTTCATCTGA
AA sequence
>Lus10034073 pacid=23154896 polypeptide=Lus10034073 locus=Lus10034073.g ID=Lus10034073.BGIv1.0 annot-version=v1.0
MEGAPKTIAHEAGAIEKDPLRFGLHGVKSDLVGSHPLQASYGSTIKTHEDMKRRVLANTYGFAFPVKMDLERQILTRFQRPAGAIPSSMLGLEAMTGSLD
DFGFEDYLNDPRESEVYRPVDMHHGLEVHLALSKGPVQGSFI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38660 APE1 acclimation of photosynthesis ... Lus10034073 0 1
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10035470 1.0 0.9273
AT2G32080 PUR ALPHA-1, PU... purin-rich alpha 1 (.1.2) Lus10001782 4.2 0.9215
AT2G18390 HAL, ARL2, TTN5... TITAN 5, HALLIMASCH, ARF-LIKE ... Lus10026383 5.2 0.9185
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10040468 6.3 0.9063
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10023582 7.3 0.8941
AT1G03220 Eukaryotic aspartyl protease f... Lus10041223 8.9 0.8926
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10037416 8.9 0.8978
AT3G04780 Protein of unknown function (D... Lus10020246 9.3 0.8701
AT2G44680 CKB4 casein kinase II beta subunit... Lus10028160 9.7 0.8771
AT3G55610 P5CS2 delta 1-pyrroline-5-carboxylat... Lus10001016 9.9 0.8911

Lus10034073 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.