Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38760 79 / 1e-21 Late embryogenesis abundant protein (LEA) family protein (.1) AT5G53820 76 / 4e-20 Late embryogenesis abundant protein (LEA) family protein (.1) AT3G02480 60 / 5e-14 Late embryogenesis abundant protein (LEA) family protein (.1) AT1G52690 38 / 0.0001 LEA7 LATE EMBRYOGENESIS ABUNDANT 7, Late embryogenesis abundant protein (LEA) family protein (.1), Late embryogenesis abundant protein (LEA) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003056 [exp] 102 / 7e-31 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10007566 [exp] 97 / 1e-28 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10012179 [exp] 97 / 2e-28 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10010451 [exp] 96 / 5e-28 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10027298 [exp] 92 / 2e-26 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10039004 [exp] 88 / 4e-25 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034100 [exp] 82 / 8e-23 AT5G38760 89 / 2e-25 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003046 [exp] 78 / 3e-21 AT5G38760 82 / 1e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10026292 [exp] 61 / 1e-14 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G107800 [exp] 82 / 7e-23 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107900 [exp] 82 / 7e-23 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107100 [exp] 82 / 7e-23 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107600 [exp] 80 / 9e-22 AT5G38760 90 / 8e-26 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108300 [exp] 78 / 3e-21 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108350 [exp] 78 / 3e-21 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G106350 [exp] 78 / 5e-21 AT5G53820 42 / 9e-07 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107500 [exp] 77 / 6e-21 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108400 [exp] 77 / 8e-21 AT5G38760 97 / 2e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107700 [exp] 71 / 2e-18 AT5G53820 75 / 6e-20 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034081 pacid=23154682 polypeptide=Lus10034081 locus=Lus10034081.g ID=Lus10034081.BGIv1.0 annot-version=v1.0 ATGGATTCACAGAAGAGCAGCTTCCAAGCTGGCGAAACCAAGGGCCAAGCTCAGGAGAAAGCTAGCGGCATGATGGATAAAGCCAGCAACGCTGCCCAAT CGGCCAAGGAATCACTCCAAGAGGCTGGATCGCAAATGCAGGCCAAGGCACAGGGTGTTGCCGAGGTTACAAAAGACAAGCTTGGAATGAACAACTAA
AA sequence Show only first row Show all	>Lus10034081 pacid=23154682 polypeptide=Lus10034081 locus=Lus10034081.g ID=Lus10034081.BGIv1.0 annot-version=v1.0 MDSQKSSFQAGETKGQAQEKASGMMDKASNAAQSAKESLQEAGSQMQAKAQGVAEVTKDKLGMNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38760			Late embryogenesis abundant pr...		Lus10034081 [exp]	0	1

Compare expression of checked genes

Lus10034081 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.