Lus10034098 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 368 / 8e-129 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 360 / 5e-126 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 359 / 2e-125 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 351 / 3e-122 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 348 / 3e-121 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 347 / 4e-121 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57540 330 / 4e-114 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 329 / 1e-113 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT4G25820 327 / 1e-112 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT5G48070 320 / 6e-110 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003048 552 / 0 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 531 / 0 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 517 / 0 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 513 / 0 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 511 / 0 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 508 / 0 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 431 / 1e-153 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 430 / 1e-153 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 430 / 2e-153 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 427 / 3e-152 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 424 / 4e-151 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 417 / 2e-148 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 395 / 7e-140 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G236200 384 / 2e-135 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.014G146100 383 / 7e-135 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 376 / 4e-132 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.013G005700 360 / 3e-125 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 355 / 6e-124 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 352 / 1e-122 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10034098 pacid=23154693 polypeptide=Lus10034098 locus=Lus10034098.g ID=Lus10034098.BGIv1.0 annot-version=v1.0
ATGGCGACAACTCTGCCTCTGGTGATGCTACTAGTGATGGCGTTGAGTACTCATCTAATGCCAATCTCGAATGCCAACTTCCACCAGCATTTTGATGTCA
CTTGGGGGCATCACCATGCTCAGATCACCAACGGCGGGCAGCAACTCGCCCTCTCCCTCGACAAGGATTCGGGCGCTGGCTTCAAATCCAAGAACGAGTA
TCTCTTTGGCCGTATCGATATGCAACTCAAGCTCATCGCTGGCAATTCTGCTGGGAGTGTCACCACCTTTTACTTGTCGTCGGAAGAAGGACCGAATCAC
GACGAAATCGACTTCGAGTTTCTTGGCAATTCCAGTGGTAATCCTTACACTCTGCACACCAATGTGTTTAGTCAAGGAAAAGGCAACCGAGAGCAACAAT
TTCATCTCTGGTTCGACCCAACTGCGGCTTTCCACACCTACACCATCCTTTGGAATTCCCAAAGAATCATATTCTTAGTGGACAACATACCAATCAGGGT
GTTCAACAACTTGGAATCAATGGGGGTTCCATTCCCAAGCAAGAAGCCGATGAGCATTCACTCGAGCTTATGGAACGCCGATGACTGGGCCACCCAAGGC
GGAAGAGTCAAGGCCGATTGGACCAACGCTCCATTCGTCGCTTCTTACAGAAACTTCAAGGCAGAAGCTTGCGTCTGGTTGCCGTCCTCGGCCTCGTCAG
CCTGCTCTCCGGGAGGATGGCAGACTCAGGGGATTGATGCCGCCGGCCGGAACAGGATCCGGTGGGTGCAGAGCAAATATATGATCTACAATTACTGCAC
TGACTTCCAACGGTTTCCTCAGGGTGTCCCTGTTGAATGCAAGCAGTCCCGATTCCTTTGA
AA sequence
>Lus10034098 pacid=23154693 polypeptide=Lus10034098 locus=Lus10034098.g ID=Lus10034098.BGIv1.0 annot-version=v1.0
MATTLPLVMLLVMALSTHLMPISNANFHQHFDVTWGHHHAQITNGGQQLALSLDKDSGAGFKSKNEYLFGRIDMQLKLIAGNSAGSVTTFYLSSEEGPNH
DEIDFEFLGNSSGNPYTLHTNVFSQGKGNREQQFHLWFDPTAAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFPSKKPMSIHSSLWNADDWATQG
GRVKADWTNAPFVASYRNFKAEACVWLPSSASSACSPGGWQTQGIDAAGRNRIRWVQSKYMIYNYCTDFQRFPQGVPVECKQSRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10034098 0 1
AT1G21910 AP2_ERF DREB26 dehydration response element-b... Lus10003740 2.0 0.8290
AT3G54690 SETH3 Sugar isomerase (SIS) family p... Lus10003549 3.5 0.8140
AT5G51480 SKS2 SKU5 similar 2 (.1) Lus10027207 4.6 0.8050
AT5G38700 unknown protein Lus10010019 8.5 0.7633
AT4G00770 unknown protein Lus10009318 9.4 0.7099
AT1G03230 Eukaryotic aspartyl protease f... Lus10000080 9.5 0.7906
AT2G38760 ANN3, ANNAT3 annexin 3 (.1) Lus10039547 11.8 0.6944
AT4G12610 RAP74, ATRAP74 transcription activators;DNA b... Lus10017289 16.5 0.7142
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10010939 17.0 0.7996
AT4G18160 KCO6, ATTPK3, A... Ca2+ activated outward rectify... Lus10004611 18.2 0.6542

Lus10034098 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.