Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38760 63 / 4e-15 Late embryogenesis abundant protein (LEA) family protein (.1) AT5G53820 57 / 1e-12 Late embryogenesis abundant protein (LEA) family protein (.1) AT3G02480 41 / 2e-06 Late embryogenesis abundant protein (LEA) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003046 [exp] 79 / 2e-21 AT5G38760 82 / 1e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10027298 [exp] 58 / 3e-13 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10010451 [exp] 58 / 4e-13 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10039004 [exp] 57 / 8e-13 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10007566 [exp] 56 / 3e-12 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034081 [exp] 56 / 5e-12 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003056 [exp] 51 / 3e-10 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10026292 [exp] 50 / 4e-10 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10012179 [exp] 49 / 1e-09 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G107500 [exp] 72 / 1e-18 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107600 [exp] 68 / 4e-17 AT5G38760 90 / 8e-26 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108300 [exp] 68 / 6e-17 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108350 [exp] 68 / 6e-17 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107100 [exp] 67 / 9e-17 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107900 [exp] 67 / 9e-17 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107800 [exp] 67 / 9e-17 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108400 [exp] 67 / 1e-16 AT5G38760 97 / 2e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107700 [exp] 59 / 1e-13 AT5G53820 75 / 6e-20 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108500 [exp] 50 / 9e-10 AT5G38760 56 / 9e-12 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034100 pacid=23154634 polypeptide=Lus10034100 locus=Lus10034100.g ID=Lus10034100.BGIv1.0 annot-version=v1.0 ATGGCAGACAACAGCCAGAAGATGGCGTACCACGCCGGAGAGGCGAAGGGGCAAGGGCAGGAGAAGGCGAGTGGGATGATGGACAAGGCGGCCGGAGCAG CTCAGTCGACTAAGGAGTCGATGCAGGATGCTGGGCAGCAGATGAAGGCTAAGGCACAGGGTGCTGCTGACGCCGTTAAGGATGCCACCGGCATGAACAA GTCCAACTGA
AA sequence Show only first row Show all	>Lus10034100 pacid=23154634 polypeptide=Lus10034100 locus=Lus10034100.g ID=Lus10034100.BGIv1.0 annot-version=v1.0 MADNSQKMAYHAGEAKGQGQEKASGMMDKAAGAAQSTKESMQDAGQQMKAKAQGAADAVKDATGMNKSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38760			Late embryogenesis abundant pr...		Lus10034100 [exp]	0	1
AT5G49630		AAP6	amino acid permease 6 (.1)		Lus10028236 [exp]	2.0	0.7677
AT5G38195			Bifunctional inhibitor/lipid-t...		Lus10033573 [exp]	7.1	0.7580
AT5G06760		AtLEA4-5, LEA4-...	Late Embryogenesis Abundant 4-...		Lus10012018 [exp]	13.0	0.7718
AT5G67090			Subtilisin-like serine endopep...		Lus10009365 [exp]	14.0	0.8048
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10030156 [exp]	16.9	0.7961
					Lus10007681 [exp]	19.1	0.7028
AT3G11920			glutaredoxin-related (.1)		Lus10034196 [exp]	20.5	0.7018
AT3G01570			Oleosin family protein (.1)		Lus10028035 [exp]	24.0	0.6020
AT3G49050			alpha/beta-Hydrolases superfam...		Lus10039240 [exp]	36.7	0.7101
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10003530 [exp]	39.9	0.7544

Compare expression of checked genes

Lus10034100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.